Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G67250-AT5G38650
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Proteasome maturation factor UMP1
Function (paralog2):Proteasome maturation factor UMP1

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-1.0103435284432
Log2 mRNA fold difference:-0.78324675066858
Log2 TE fold difference:-0.26149657931115
Sequences
Protein sequence

MESEKKIAHEIGGVKNDALRFGLHGVKSNIIGSHPLESSYESEKKSKEALKRTVIAHAYG
TALPLKMDMDRQILSRFQRPPGPIPSSMLGLEVYTGAVDDFGFEDYLNDPRDSETFKPVD
FHHGMEVRLGISKGPIYPSFM

MESQKKIAHEIGGMKNDALRFGLHGVKSDILRSHPLETAYESGKQSQEEMKRRVITHTYG
AALPLKMDLDRQILSRFQRPPGPIPSSMLGLEVYTGALDNFGFEDYLNDPRESETLKPVD
FHHGMEVRLGLSKGPASPSFM

Other information
Ka divergence:-0.396528KaKs divergence:0.00194175
GC content 1 (%):47GC content 2 (%):46GC content divergence:-0.011
Length 1 (bp):426Length 2 (bp):426Length divergence:0
MFE 1 (kcal):-136.7MFE 2 (kcal):-124.9MFE divergence-0.045