Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G67650-AT1G67680
Species:Arabidopsis
Duplication type:TD
Function (paralog1):SRP72 RNA-binding domain
Function (paralog2):SRP72 RNA-binding domain

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:2.8264035871212
Log2 mRNA fold difference:2.8424368147195
Log2 TE fold difference:-0.033877767440897
Sequences
Protein sequence

MAPKSKENPKTSTPAIEDLFTSLHKHIKDTKYEEAVKVADQVLSIVPTDEDAIRCKVVAL
IKDDKFDDYLIKDVKINGALSVINSFPIDLGFHKAYCLYRENKLDEALVCLKGLERESKT
LLLEAQILNCLGKVDACVDVYQKLNKSGIKLIEVNLVAALIRAGKASQVLESLKIRPTTT
YQLAYNTACSLIENSNYVDAEQLLLTAMRIGQETLTEGDYSDDYIETQLAPISVQLAYVQ
QVLGQTQESKSSYVDIIKRNLADESLALAVNNLVALKGSKDISDGLRKFDLLKDKDSQNF
QLSQELDAKLSHKHKEAIYANRVLLLLHANKMDQARELCATLPGMFPESVIPTLLQAAVL
VRENKAAKAEELLGQCAENFPEKSKLVLLARAQIAASASHPHVAAESLSKIPDIQHLPAT
VATIVALRERAGDNDGATAVLDSAIRWWSDSMTDSNMLRILMPVAAAFKLRHGQEEEASR
LYEEIVKNHNSTDALVGLVTTLARVNVEKAEAYEKQLKPLPGLKAVDVDNLEKTSGAKPI
EGISAASLSQEEVKKEKVKRKRKPKYPKGFDLENSGPTPDPERWLPRRERSSYRPKRKDK
RAAQIRGSQGALTKVKQEEAPSTSKSKQAAISKANAAGPSSSKASKKKSRR

MAPKSKEKSKTSNSQPPPAIEDLFTSLHQHIKDTKYEEAVKVADQVLSIVPTDEDAIRCK
VVALIKDDKFDDYLIKDVKINGALSVINSFQKLPIDLGFHKAYCLYRVNKLDEALVCLKG
LERDTDTLVLEAQILYRLGKADACVDVYQKLTKSQIETLEVNLVAGLISAGKASQVQKTL
ESLKIKPTSSFELAYNTACSLIENNNYADAEQLLLTARRIGQETLNDDDIALTDEEIEIE
LAPIAVQLAYVQQILGQTQESTSSYVDFIKRNLADEPSLAVAVNNLVALKGFKDISDGLR
KFDLLKDKDSQTFQLSQALDAKLSQKHKEAIYANRVLLLLHANKMDQARELCAALPGMFP
ESIIPTLLQAAVLVRENKAAKAEELLGQCAEKFPEKSKLVLLARAQIAASASHPHVAAES
LSKIPDIQHLPATVATIVALKERAGDNDGAAAVLDSAIKWWSNSMTESSKLRVLMPEAAA
FKLRHGQEEEASRLYEEIVKNHNSTDALVGLVTTLARVNVEKAESYEKQLKPLPGLKAVD
VDKLEKTYGAKPIEGAAASSSQEEVKKEKAKRKRKRKPKYPKGFDPANPGPPPDPERWLP
RRERSSYKPKRKDKRAAQIRGSQGAVTKDKQEAAPSTSKSNQVASSKGNAPAPSSKASKK
KSRR

www.000webhost.com

Other information
Ka divergence:-0.518331KaKs divergence:-0.124533
GC content 1 (%):44GC content 2 (%):44GC content divergence:0
Length 1 (bp):1956Length 2 (bp):1995Length divergence:0.01
MFE 1 (kcal):-581.62MFE 2 (kcal):-588.82MFE divergence0.006