Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G68260-AT1G68280
Species:Arabidopsis
Duplication type:TD
Function (paralog1):Thioesterase superfamily protein
Function (paralog2):Thioesterase superfamily protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-2.0267939953855
Log2 mRNA fold difference:-3.132555571523
Log2 TE fold difference:1.4322665359146
Sequences
Protein sequence

MFLQVTGTATPAMPAVVFLNSWRRPLSIPLRSVKTFKPLAFFDLKGGKGMSEFHEVELKV
RDYELDQFGVVNNAVYANYCQHGRHEFLESIGINCDEVARSGEALAISELTMKFLSPLRS
GDKFVVKARISGTSAARIYFDHFIFKLPNQEPILEAKGIAVWLDNKYRPVRIPSSIRSKF
VHFLRQDDAV

MIRVTGTAAPAMSVVFPTSWRQPVMLPLRSAKTFKPHTFLDLKGGKEMSEFHEVELKVRD
YELDQFGVVNNAVYANYCQHGMHEFLESIGINCDEVARSGEALAISELTMNFLAPLRSGD
KFVVKVNISRTSAARIYFDHSILKLPNQEVILEAKATVVWLDNKHRPVRIPSSIRSKFVH
FLRQNDTV

www.000webhost.com

Other information
Ka divergence:0.386486KaKs divergence:0.734788
GC content 1 (%):45GC content 2 (%):44GC content divergence:-0.011
Length 1 (bp):573Length 2 (bp):567Length divergence:-0.005
MFE 1 (kcal):-153.3MFE 2 (kcal):-176.5MFE divergence0.07