Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G69520-AT1G69523
Species:Arabidopsis
Duplication type:TD
Function (paralog1):S-adenosyl-L-methionine-dependent methyltransferases superfamily protein
Function (paralog2):S-adenosyl-L-methionine-dependent methyltransferases superfamily protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:0.84204252923517
Log2 mRNA fold difference:0.41167976256286
Log2 TE fold difference:0.50051767213127
Sequences
Protein sequence

MLGVQRIFQEHIIRRGRWCIRRVYSWFFNLLMQSYWNEIEDCKVKIFDKLSEKAEKVLEI
GIGTGPNMRYYAARNSNVTLYGLDPNPKMKKYARKSATKAGLKPKNFRFKQGVGEAIPLK
DNSVDAVVATLVLCSVSDVTQTLKEIKRVLRQGGVFIFLEHVAAKDGSFFKRLQKLLDPL
QQRLADGCHLARNTRECILEAGFSGGVEVQTFSMYSFPWMTRPHIYGLAYN

MEILHFSPSSSISTIIHRPRRKIMALRDSIKTQMNLITTESVSSFRFCPCGRRHFIGAAM
TSMPFLPISPSHASTSTEDLKRLRPPKPDWYEEFFAWSMNSEVESYEKEVSDYKMKLFDN
LVGKAEKVLEIGIGTGPNFKYYTDIPNVSVIGIDPNAKMESYARKSATEAGLKPEEFTFV
HALGESIPLEDASVDAVVGTLVLCSVTDVTQTLKEIKRILRPGGIYIFIEHVAAEDGTFL
RLVQTVLDPLQQVVADGCHLTRHTGESILEARFNGGADVKKTSLSRLAYISSHVYGVAYN

www.000webhost.com

Other information
Ka divergence:-0.291899KaKs divergence:0.383938
GC content 1 (%):41GC content 2 (%):41GC content divergence:0
Length 1 (bp):696Length 2 (bp):903Length divergence:0.129
MFE 1 (kcal):-197.46MFE 2 (kcal):-257.9MFE divergence0.133