Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G70670-AT1G70680
Species:Arabidopsis
Duplication type:TD
Function (paralog1):Caleosin-related family protein
Function (paralog2):Caleosin-related family protein

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:-3.8987117849876
Log2 mRNA fold difference:-4.9995842219829
Log2 TE fold difference:1.1413935286648
Sequences
Protein sequence

MASSISTGVKFVPEEDNFLQRHVAFFDRNKDGIVYPSETFQGFRAIGCGYLLSAVASVFI
NIGLSSKTRPGKGFSIWFPIEVKNIHLAKHGSDSGVYDKDGRFVASKFEEIFTKHAHTHR
DALTNEELKQLLKANKEPNDRKGWLAGYTEWKVLHYLCKDKNGLLHKDTVRAAYDGSLFE
KLEKQRSSKTSKKHP

MASSISAAEVKVVPEEYNFLQKHVAFFDRNKDGIVYPSETFQGFRAIGCGYLLSTFAAVF
INISLSSKTRPGKGFSFSFPIEVKNVRLGIHSSDSGVYDKDGRFVASKFEEIFAKHAHTH
RDALTSKELKELLKANREPNDCKGGILAFGEWKVLYNLCKDKSGLLHKEIVRAVYDGSLF
EQLEKQRSSKTP

www.000webhost.com

Other information
Ka divergence:0.326096KaKs divergence:0.999795
GC content 1 (%):41GC content 2 (%):43GC content divergence:0.024
Length 1 (bp):588Length 2 (bp):579Length divergence:-0.008
MFE 1 (kcal):-158MFE 2 (kcal):-163.02MFE divergence0.016