Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G70830-AT1G70840
Species:Arabidopsis
Duplication type:TD
Function (paralog1):MLP-like protein 28
Function (paralog2):MLP-like protein 31

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:-10.16295385828
Log2 mRNA fold difference:-8.765551375574
Log2 TE fold difference:-1.413217970768
Sequences
Protein sequence

MADVATKHPMEDEVKKTEASSLVGKLETDVEIKASADKFHHMFAGKPHHVSKASPGNIQG
CDLHEGDWGTVGSIVFWNYVHDGEAKVAKERIEAVEPDKNLITFRVIEGDLMKEYKSFLL
TIQVTPKPGGPGSIVHWHLEYEKISEEVAHPETLLQFCVEVSKEIDEHLLAEEEEVKTPE
TPSLVGKLETDVEIKASAEKFHHMFAGKPHHVSKASPGNIQGCDLHEGDWGQVGSIVFWN
YVHDREAKVAKERIEAVEPNKNLITFRVIDGDLMKEYKSFLLTIQVTPKLGGPGSIVHWH
LEYEKISEEVAHPETLLQFCVEVSKEIDEHLLAEE

MATKMAGAAMNLAKRESSSLCGKLETDIEIKASAGKFHHMFAGRPHHVSKATPGKIQGCE
LHEGDWGKVGSIVFWNYVHDGEAKVAKERIEAVEPEKNLITFRVIEGDLLKEYKSFVITI
QVTPKRGGPGSVVHWHVEYEKIDDKVAHPETFLDFCVEVSKEIDEHLLNEE

www.000webhost.com

Other information
Ka divergence:0.128762KaKs divergence:-0.230539
GC content 1 (%):50GC content 2 (%):46GC content divergence:-0.042
Length 1 (bp):1008Length 2 (bp):516Length divergence:-0.323
MFE 1 (kcal):-355MFE 2 (kcal):-157.46MFE divergence-0.385