Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G71170-AT1G71180
Species:Arabidopsis
Duplication type:TD
Function (paralog1):6-phosphogluconate dehydrogenase family protein
Function (paralog2):6-phosphogluconate dehydrogenase family protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.32418625370376
Log2 mRNA fold difference:-0.031467003346905
Log2 TE fold difference:-0.3006765806651
Sequences
Protein sequence

METQYPKLIEPSKTRIGWIGIGIMGSAMVSHILAAGYSVTVYARDLRKTKDLQTKGGRTA
NSPKELGEMSDVVFTIVGNSNDVRSLLLGDDGVLSGLKPGGVTVDMTSSKPGLAREIYAE
ARRRDCWAVDAPVSGGDAGAREGKLTIFAGGDSEIVEWLAPVMKTMGIVRFMGGAGSGQS
CKIGNQICVGSNMIGLAEGIVFAEKAGLDPVKWLEAVKDGAAGSAVMRLFGEMMAVRDYK
ATGFAEYMVKDLGMAAEAAMAMPGTALNKQLFTVMVANGDGKLGFQGVVDVIRRLNGLS

MFYQSSSSLTQILHSFCGNTEMETPYPKLIDPSKTRIGWIGIGIMGSAMVSHIIAAGYSV
TVYARDLRKTKDLQTKGARIANSPKELAEMSDVVFTIVGNFNDVRSLLLGDDGVLSGLTP
GGVTVDMTSSKPGLAREIHAEARRRNCWAVDAPVSGGDAGAREGTLGIFAGGDSEIVEWL
SPVMKNIGTVTYMGEAGSGQSCKIGNQIAGASNLVGLAEGIVFAEKAGLDTVKWLEAVKD
GAAGSAVMRLFGEMIVKRDYRATGFAEYMVKDLGMAAEAAMPGAALSKQLFTGMVANGDG
KLGIQGVVSVIRRLNGIS

Other information
Ka divergence:-0.229844KaKs divergence:0.838161
GC content 1 (%):51GC content 2 (%):50GC content divergence:-0.01
Length 1 (bp):900Length 2 (bp):957Length divergence:0.031
MFE 1 (kcal):-314.1MFE 2 (kcal):-331.49MFE divergence0.027