Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G71270-AT1G71300
Species:Arabidopsis
Duplication type:TD
Function (paralog1):Vps52 / Sac2 family
Function (paralog2):Vps52 / Sac2 family

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-2.7461042718566
Log2 mRNA fold difference:-3.3261417564361
Log2 TE fold difference:0.57533889936872
Sequences
Protein sequence

MSDISIDALGQTMGDFSNHEKLGFDLGAFVGDLAFEEDSGSEDISLEGLQQELEECESDE
VVANILSSGDKLREYAKGVENNLRKVELDSIEDYIKESDNLVSLHDQIRDCDSILSQMET
LLSGFQEEIGSISSDIKILQEKSMDMGLRLKNRRVAESKLAKFVEDIIVPPKMIDVIVDG
EVNEEYMKTLEILSKKLKFVEADQAVKSSKALKDVEPELEKLRQKAISKVYDFIVQKLIA
LRKPKTNIQILQQSVLLKYKYIISFLKEHGKEVFMDVRAAYIDTMNKVLSAHFRAYIQAL
EKLQLDIATAYDLIGVETRTTGLFSRAREPLKNRSAVFALGDRIKIIKDIDQPALIPHIA
EASSLKYPYEVLFRSLHKLLMDTATSEYMFCDDFFGEESIFYEIFAGPFSVIDEHFNPVL
SNCFDAIGLMLMIRIIHHHQLIMSRRRIPCLDSYLDKVNISLWPRFKMVFDSHLSSLRDA
NIKTLWEDDVHPHYVMRRYAEFTASFIHLNVEYGDGQLDINLERLRMAVDGLILKLAKLF
PRPKQQIVFLINNYDMTIAVLKEAGPEGGKIQMHFEEMLKSNTSLFVEELLVEHFSDLIK
FVKNRASEDSSLNPERSITIAEVEPLVKDFGSRWKTAIELMDKDIITSFSNFLCGMDILR
AALTQLLLYYTRLTDCIKKIDGGSALNRDLVSIQSIMYEIRKYSKTF

MDDFSNLEKHESELGAFFGDLAFEEDSRRMLSFGSVSFIKSTLLFLLGSEDISLEGLQQE
LEECESDEVVANILSSGDKLREYAKGVENNLRKVELDSVEVAILLPDYIKESDKLVSLHD
QIRDCNCILSQMETLLSGFQEEIGSISSDIKILQENSMDMGLRLKNRRVTESKLAKFVED
FIVPPKMIHVIVDGEVNEEYIKTLGILSKKLKFVETDQAVKSSKALKDVEPELEKLRQKA
ISKVYDFIVQKLIALRKPKTNIQILQQSVFLKYKYIISFLKEHGKEVFMDVRAAYIDTMN
KVLSAHFQSYIQAFEKLQLDIATSNDLIGVDTRSTGLFSRSKEPLKNRCAVFALGERIQI
IKEIDQPALIPHIAEASSLKYPYEVLFRSLHKLLMDTATSEYIFCEDFFGEQSIFYEIFA
GPFSVIYEHLDSVLSSCYDAIGLLLMIRIIHHHQLIMSRRRIPCLDSYLDKVNISLWPRF
KTVFDLHIGSLRNANINTIWEDDVHPHYIMRRYAEFTASFIHLNVEYGDGQLDINLERLR
MAVDSLILKLAKLFPRPKQQMVFLINNYDMTIAVLKEAEPEGGKIQMHFEELLKSNTSLF
AEELLVEHFSDMIKFVKSRANEDSSPNLERSITVAEVEPLVKDFGSRWKTAIELMHKDII
TCFSNFLCGMDILIAGMTQLLLYYTRLEDCIKKIDGGSALNRDIVNYQSIMFEIKKYKKT
F

Other information
Ka divergence:0.630225KaKs divergence:0.301587
GC content 1 (%):40GC content 2 (%):39GC content divergence:-0.013
Length 1 (bp):2124Length 2 (bp):2166Length divergence:0.01
MFE 1 (kcal):-600MFE 2 (kcal):-599.76MFE divergence0