Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G71880-AT1G71890
Species:Arabidopsis
Duplication type:TD
Function (paralog1):sucrose-proton symporter 1
Function (paralog2):Major facilitator superfamily protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-5.085329458712
Log2 mRNA fold difference:-5.8775168465186
Log2 TE fold difference:0.66919041338456
Sequences
Protein sequence

MGAYETEKPTKDAAALETQSPEDFDQPSPLRKIISVASIAAGVQFGWALQLSLLTPYVQL
LGIPHKWSSLIWLCGPVSGMIVQPIVGFHSDRCRSKFGRRRPFIATGAALVAVAVFLIGY
AADFGYKMGDKLEEKVKVRAIGIFALGFWILDVANNTLQGPCRAFLADLAAGDAKRTRVA
NAFFSFFMAVGNVLGYAAGSYTNLHKMFPFTMTKACDIYCANLKTCFFLSITLLLIVTVT
SLWYVNDKQWSPPPRNADDDEKTSSVPLFGEIFGAFKVMKRPMWMLLIVTALNWIAWFPF
LLFDTDWMGREVFGGDSDGNERSKKLYSLGVQSGAMGLMFNSIVLGFMSLGVEWIGRKLG
GAKRLWGIVNFILAAGLAMTVLVTKFAEDHRKTAGDLAGPSASVKAGALSLFAVLGIPLA
ITFSTPFALASIFSSCSGAGQGLSLGVLNLAIVIPQMIVSLGGGPFDALFGGGNLPAFIV
AAIAAAISGVLALTVLPSPPPDAPKATTMGGFH

MGALEAERAANNATALETQSSPEDLGQPSPLRKIISVASIAAGVQFGWALQLSLLTPYIQ
LLGIPHKWSSYMWLCGPISGMIVQPIVGYHSDRCESRFGRRRPFIAAGVALVAVSVFLIG
FAADMGHSFGDKLENKVRTRAIIIFLTGFWFLDVANNTLQGPCRAFLADLAAGDAKKTRV
ANACFSFFMAVGNVLGYAAGSYTNLHKMFPFTMTKACDIYCANLKTCFFLSITLLLIVTF
SSLWYVKDKQWSPPQGDKEEKTSSLFFFGEIFGAVRHMKRPMVMLLIVTVINWIAWFPFI
LYDTDWMGREVYGGNSDGDERSKKLYDQGVQAGALGLMFNSILLGFVSLGVESIGRKMGG
AKRLWGCVNFILAIGLAMTVLVTKSAEHHREIAGPLAGPSSGIKAGVFSLFTVLGIPLAI
TYSIPFALASIFSTNSGAGQGLSLGVLNIAICIPQMIVSFSSGPLDAQFGGGNLPSFVVG
AIAAAVSGVLALTVLPSPPPDAPAMSGAMGFH

Other information
Ka divergence:0.289254KaKs divergence:0.55359
GC content 1 (%):48GC content 2 (%):47GC content divergence:-0.011
Length 1 (bp):1542Length 2 (bp):1539Length divergence:-0.001
MFE 1 (kcal):-504.87MFE 2 (kcal):-494.6MFE divergence-0.01