Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G72120-AT1G72125
Species:Arabidopsis
Duplication type:TD
Function (paralog1):Major facilitator superfamily protein
Function (paralog2):Major facilitator superfamily protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:0.2537138532662
Log2 mRNA fold difference:-0.99809714268214
Log2 TE fold difference:1.1757425361689
Sequences
Protein sequence

MTTTSEISLQEEYVTDAVDHRGLAARRSNTGRWRAALFIIGVEVAERFAYYGIGSNLISY
LTGPLGESTAVAAANVNAWSGIATLLPVLGAFVADAFLGRYRTIIISSLIYVLGLAFLTL
SAFLIPNTTEVTSSTSSFLNVLFFFSLYLVAIGQSGHKPCVQAFGADQFDEKDSQEKSDR
SSFFNWWYLSLSAGICFAILVVVYIQEEFSWAFGFGIPCVFMVISLVLFVSGRRIYRYSK
RRHEEEINPFTRIGRVFFVALKNQRLSSSDLCKVELEANTSPEKQSFFNKALLVPNDSSQ
GENASKSSDVEDATALIRLIPVWFTTLAYAIPYAQYMTFFTKQGVTMDRTILPGVKIPPA
SLQVFIGISIVLFVPIYDRVFVPIARLITKEPCGITTLKRIGTGIVLSTITMVIAALVEF
KRLETAKEHGLIDQPEATLPMSIWWLIPQYLLLGLADVYTLVGMQEFFYSQVPTELRSIG
LALYLSALGVGSLLSSLLISLIDLATGGDAGNSWFNSNLNRAHLDYFYWLLAIVSAVGFF
TFLFISKSYIYRRVDRV

MTTTSKTSLQEEYVIDAVDHRGFSARRSITGRWRAAWFIIGVEVAERFANYGIGSNLISY
LTGPLGQSTAVAAANVNAWSGISTILPLLGAFVADAFLGRYITIIIASFIYVLGLAFLTL
SAFLIPNNTEVTSSPSSFLNALFFFSLYLVAIGQSGHKPCVQAFGADQFDEKNPQENSDR
SSFFNWWYLSMCAGIGLAILVVVYIQENVSWALGFGIPCVFMVISLVLFVLGRKSYRFSK
TRQEEETNPFTRIGRVFFVAFKNQRLNSSDLCKVELIEANRSQESPEELSFLNKALLVPN
DSDEGEVACKSRDVEDATALVRLIPVWLTTLAYAIPFAQYMTFFTKQGVTMERTIFPGVE
IPPASLQVLISISIVLFVPIYDRVLVPIGRSITKDPCGITTLKRIGTGMVLATLTMVVAA
LVESKRLETAKEYGLIDQPKTTLPMSIWWLFPQYMLLGLADVHTLVGMQEFFYSQVPTEL
RSLGLAIYLSAMGVGSLLSSLLIYLIDLATGGDAGNSWFNSNLNRAHLDYFYWLLAVVSA
VGFFTFLFISKSYIYRRVDVV

www.000webhost.com

Other information
Ka divergence:0.216151KaKs divergence:-0.458231
GC content 1 (%):44GC content 2 (%):44GC content divergence:0
Length 1 (bp):1674Length 2 (bp):1686Length divergence:0.004
MFE 1 (kcal):-507.1MFE 2 (kcal):-522.31MFE divergence0.015