Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G73270-AT1G73280
Species:Arabidopsis
Duplication type:TD
Function (paralog1):serine carboxypeptidase-like 6
Function (paralog2):serine carboxypeptidase-like 3

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:0.75940019552932
Log2 mRNA fold difference:0.67603262731617
Log2 TE fold difference:0.045779689031761
Sequences
Protein sequence

MANDYISFVFKSLLLLIHLVFLGQHHVDSASVVKSLPGFEGPLPFELETGYIGVGEEEEV
QLFYYFIKSERNPKEDPLLLWLTGGPGCSAISGLLYENGPLTMKLDVYNGTLPSLVSTTY
SWTKNSSMIFLDQPVGTGFSYSRTELFNKPSDTGEAKRIHEFLQKWLGKHQEFSSNPFYV
GGDSYSGITVPATVQEISKGNYQCCKPPINLQGYMLGNPITDSKIDGNSQIPYAHGMALI
SDELYESLKRICKGEYEHVDPYNTECLKLLEEFNECTSKLYRSHILYPLCEMTNPDCYIY
RYSLSHYWVNDETVRKALQINKESIREWKRCDWSKPYTKDIISSVPYHMNNSINGYRSLI
FSGDHDFEVPLIGTQVWIKSLNYAIVDKWRPWMINNQVAGYTRTYANKMTFATVKGGGHT
AEYKPDETFIMFQRWINGQALYGKVKLLQKTE

MASNYVFSVLRSLLLLIHTVFLGQHHVSSATIIKSLPGFEGPLPFELETGYIGVGEEEEV
QLFYYFIKSERNPKEDPLLLWLSGGPGCSSISGLLFENGPLAMKLDVYNGTLPSLVSTTY
SWTKASSMIFLDQPVGAGFSYSRTQLLNKPSDSGEAKRIHEFLQKWLGKHQEFSSNPFYV
GGDSYSGMVVPATVQEISKGNYECCNPPINLQGYVLGNPLTDFVYDYNSRIPFAHGMALI
SDELFESLKKTCKGDYRNVHPRNTECLKFIEEFNKCTNSICQRRIIDPFCETETPNCYIY
RFLLAAYWANDETVRKALQIKKETIGEWVRCHYGIPYNYDIKSSIPYHMNNSINGYRSLI
YSGDHDFEVPFLGTQAWIRSLNYSVIDDWRPWMIKDQIAGYTRTYANKMTFATIRGGGHT
IEFKPEEASIMFQRWIKGQPL

Other information
Ka divergence:0.0700799KaKs divergence:0.169027
GC content 1 (%):40GC content 2 (%):41GC content divergence:0.012
Length 1 (bp):1359Length 2 (bp):1326Length divergence:-0.012
MFE 1 (kcal):-371.42MFE 2 (kcal):-370.7MFE divergence-0.001