Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G73450-AT1G73460
Species:Arabidopsis
Duplication type:TD
Function (paralog1):Protein kinase superfamily protein
Function (paralog2):Protein kinase superfamily protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:0.535182582952
Log2 mRNA fold difference:0.72016384261957
Log2 TE fold difference:-0.14743455536293
Sequences
Protein sequence

MADQSSVDGILEFLRNNRFSNAEEALRNELSNRSDINGFLQKLMLEEKDSSKDSNERANG
KELRRSGSRDSEVSKELVVKEVDCGTSTTGSVIKWENGAAAENPSKKETFVPSEMSFTFS
KNSGDAAAPPDAHSYEFTSGNGTLEPYGNIDDNSSSSLVDSYAIEQLADIDKKIVETGED
IVFFGNKSTLLSGNSSKGNSGSKIKKPNEIDQLGEIFGKHDSYKGSVLLRTEDVIDTSEN
WKERSVKTLFQSSRGDASNSYNLVSSSDKREGKKKAEISDVRVAIKEQESEVARALFFGK
SQSTFDDKNISSLGFPLVFDTRKEEFPRLPPVKLKSEDNPLSLHCEEKFERDGSGPRLIN
DDEALLIGSYLDVPIGQEISSSGGKKSGGGNWLSVSQGIADLVSGFATIGDGLSESVDYR
NEYWDSDEYEDDGDIGYVRQPIEDETWFLAHEIDYPSDHEKGTTRGSPDHHDRDANKDED
DQSYAEDESYLSGERYLQSKDAEPISSENDRRLTVSEIYPACKKNDLLAQYDGQLMDEDL
LNSMRTEPVWQGFVAQSNELVMLGDKKGINVHRKSHLDDVYVEDDQHDSVRSIGVGINSD
AADFGSEVRDSLAGGSSEGDFEYSRDHDPVASRFKQLYSESDKKHIDGQNKNKQKASKND
SGGSFHVKIQTDGDFSFGSSQKDGQLMHAESSKSLWSGNRETVTRDRNTELLSASTATDD
MVATWRQKSSDSSSSRSSVKENNATSIKSVNSSPSSLSNYARGERKHAEKENDSSEREDG
HATALDDEEAVAVQEQVRQIKAQEEEFETFDLKIVHRKNRTGFEEEKNFNVVLNSVIAGR
YHVTEYLGSAAFSKAIQAHDLQTGMDVCIKIIKNNKDFFDQSLDEIKLLKYVNKHDPADK
YHLLRLYDYFYYREHLLIVCELLKANLYEFHKFNRESGGEVYFTMPRLQSITIQCLESLQ
FLHGLGLIHCDLKPENILVKSYSRCEIKVIDLGSSCFETDHLCSYVQSRSYRAPEVILGL
PYDKKIDVWSLGCILAELCTGNVLFQNDSPASLLARVMGIVGSFDNEMLTKGRDSHKYFT
KNRMLYERNQESNRLEYLIPKRTSLRHRLPMGDQGFTDFVAHLLEINPKKRPSAAEALKH
PWLSYPYEPISA

MTDQSSVDGILEFLRNNRFSQAEEALRNELNNRSDINGFLQKLKLEDKDSNEKAAGNELR
RSGSRDSEVSKELIVKEVDCGTSTNGSVIKWENGATADNPSKKEPVVSSEMSFTFSKNSG
DAAAPPDAHSYKFTSRNGTVEPSRNIDDSSSSSLVDLYAFEQSRHGNFADIDKKIVETGE
DIVFFGNKSTSWSGNSSKGNSGSKIKEPNEIHRLVENSGKHDSYKGSILLRSEDVVDTSA
NWRECSVKTLFQSSRGDASNSYNLVSSSDKREGKKKADISDVRVAIKEQESEVARALFFG
KSQSTFDDKNISSLGFPLVYDTRKEEFPRLPPVKLKSEDNPLSLHCEEKFERDGSGPRLI
NDEDALLIGSYLDVPIGQEISSSGGKKSTGGNWLSVSQGIAEDASDLVSGFATIGDGLSE
SVDYRNEYWDSDEYEDDDDIGYVRQPIEDEPWFLAHEIDYPSDHEKGTTRGSPDHHERDA
NKDADDQSYAEEASYISGEQYLQSKDAEPISSENDRRLTVSEIYPASKKNDLLAQYDGHL
MDEELLSSMRDEPVWQGFVAQSNELLMLGDKKGINVHRKSHRDDVYVEDDQHDSVRSIGV
GINSDAADFGSEVRDSLAGGSSEGDFEYSRDHDPVASRFKQLYSESDKKHIDAPNKNKQQ
ASKNDGPDYIADNDSSGSFHVKIQTDGGFSFGSSQKDGQSMHAESSKSLWSGNHETVTRD
RNTERLSASTAMDDMVATWRRKSSDSSSSHSSVKDNNATSIKSLNSSPSSLSNYACEERK
HADKEDDRNDSSEIEDDNATALDDEEAVAVQEQVRQIKAQEEEFETFDLKIVHRKNRTGF
EEEKNFNVVLNSVIAGRYHVTEYLGSAAFSKAIQAHDLQTGMDVCIKIIKNNKDFFDQSL
DEIKLLKYVNKHDPADKYHLLRLYDYFYYREHLLIVCELLKANLYEFHKFNRESGGEVYF
TMPRLQSITIQCLESLQFLHGLGLIHCDLKPENILVKSYSRCEIKVIDLGSSCFETDHLC
SYVQSRSYRAPEVILGLPYDKKIDVWSLGCILAELCTGNVLFQNDSPASLLARVMGIVGS
FDNEMLTKGRDSHKYFTKNRMLYERNQESNRLEYLIPKRTSLRHRLPMGDQGFTDFVAHL
LEINPKKRPSAAEALKHPWLSYPYEPISA

Other information
Ka divergence:0.0555619KaKs divergence:0.229173
GC content 1 (%):41GC content 2 (%):41GC content divergence:0
Length 1 (bp):3459Length 2 (bp):3510Length divergence:0.007
MFE 1 (kcal):-1002.94MFE 2 (kcal):-1035.88MFE divergence0.016