Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G74000-AT1G74010
Species:Arabidopsis
Duplication type:TD
Function (paralog1):strictosidine synthase 3
Function (paralog2):Calcium-dependent phosphotriesterase superfamily protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-0.14589497976135
Log2 mRNA fold difference:-0.17971107118401
Log2 TE fold difference:0.35511845311948
Sequences
Protein sequence

MMRSFVSLISLLLLLSFSSSVLSTKKSSFQKLPVPGNRTGPEAFAFDSTGKGFYTGVTGG
KILKYLPKKGYVDFAQITNSSKSSLCDGALGTTNVEKCGRPAGIAFNTKTGDLYVADAAL
GLHVIPRRGGLAKKIADSVGGKPFLFLDGLDVDPTTGVVYFTSFSSTFGPRDVLKAVATK
DSTGKFFKYDPSKKVVTVLMEGLSGSAGCAVSSDGSFVLVGQFTKSNIKRYWIKGSKAGT
SEDFTNSVSNPDNIKRIGSTGNFWVASVVNSATGPTNPSAVKVSSAGKVLQTIPLKDKFG
DTLVSEVNEYKGQLYIGALFGPFAGILKL

MASFVFVISLLLLSFSSAVFSDDASFQKLPVPDKRSGPESFAFDSTGGFYTGVSGGKILK
YVPGKGYVDFAQITDSSNSAWCNGALGTAFAGKCGRPAGIALNSKTGDLYVADAPLGLHV
ISPAGGLATKLADSVDGKPFKFLDGLDVDPTTGVVYFTSFSSKFGPREVLIAVGLKDASG
KLFKYDPATKAVTELMEGLSGAAGCAVSSDGSFVLVSEFIKSNIKKYWIKGPKAGTIEDF
SSLVSNPDNIRRVGSTGNFWVASVVNKVVMPTDPRAVKLDANGKVLQTIFLKNEFGNTLL
SEVNEFNGHLYIGTLTGPFAGVMKL

Other information
Ka divergence:-0.108092KaKs divergence:-0.800932
GC content 1 (%):47GC content 2 (%):48GC content divergence:0.011
Length 1 (bp):990Length 2 (bp):978Length divergence:-0.006
MFE 1 (kcal):-310.77MFE 2 (kcal):-317.26MFE divergence0.01