Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G74090-AT1G74100
Species:Arabidopsis
Duplication type:TD
Function (paralog1):desulfo-glucosinolate sulfotransferase 18
Function (paralog2):sulfotransferase 16

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:1.5768755001107
Log2 mRNA fold difference:1.8118680905323
Log2 TE fold difference:-0.27955512385366
Sequences
Protein sequence

MESETLTAKATITTTTLPSHDETKTESTEFEKNQKRYQDLISTFPHEKGWRPKEPLIEYG
GYWWLPSLLEGCIHAQEFFQARPSDFLVCSYPKTGTTWLKALTFAIANRSRFDDSSNPLL
KRNPHEFVPYIEIDFPFFPEVDVLKDKGNTLFSTHIPYELLPDSVVKSGCKMVYIWREPK
DTFISMWTFLHKERTELGPVSNLEESFDMFCRGLSGYGPYLNHILAYWKAYQENPDRILF
LKYETMRADPLPYVKSLAEFMGHGFTAEEEEKGVVEKVVNLCSFETLKNLEANKGEKDRE
DRPGVYANSAYFRKGKVGDWSNYLTPEMAARIDGLMEEKFKGTGLLEHGK

MESKTTQNGSEVVELTEFEKTQKKYQDFIATLPKSKGWRPDEILTQYGGHWWQECLLEGL
FHAKDHFEARPTDFLVCSYPKTGTTWLKALTYAIVNRSRYDDAANPLLKRNPHEFVPYVE
IDFAFYPTVDVLQDRKNPLFSTHIPNGLLPDSIVNSGCKMVYIWRDPKDTFISMWTFLHK
EKSQEGQLASLEDSFDMFCKGLSVYGPYLDHVLGYWKAYQENPDRILFLRYETMRANPLP
FVKRLAEFMGYGFTDEEEENGVAEKVVKLCSFETLKNLEANKGDKEREDRPAVYANSAYF
RKGKVGDWANYLTPEMAARIDGLVEEKFKDTGLLQHDN

Other information
Ka divergence:-0.00197524KaKs divergence:0.513245
GC content 1 (%):46GC content 2 (%):43GC content divergence:-0.034
Length 1 (bp):1053Length 2 (bp):1017Length divergence:-0.017
MFE 1 (kcal):-324.4MFE 2 (kcal):-315.28MFE divergence-0.014