Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G74170-AT1G74180
Species:Arabidopsis
Duplication type:TD
Function (paralog1):receptor like protein 13
Function (paralog2):receptor like protein 14

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-0.68780399704664
Log2 mRNA fold difference:-0.68726983718807
Log2 TE fold difference:-0.032812627708413
Sequences
Protein sequence

MGVECNRKSGRITNIAFGIGFIIENPLLNLSLLHPFEDVRSLDLSSSRSCEDCGFSGLFD
DVEGYKSLSRLRNLEILDLSSHRFNNSIFPFLNAATSLTTLFLTYNNMHSPFLVKEFKDL
TNLEHLDLRGNRFNGSIPTQDYNSLRRFRKLEILDLSDNLFNSRIFPFLNSATSLKSLSL
WGNNMGGPFPAKELRDLTNVELLDLSRNRFNGSIPVRALFALRKLKALDLSDNEFSSSVE
LQGKFAKTKPLSGTCPWKNMEELKLSNNKLAGQFPLCLTSLTGLRVLDLSSNQLTGNVPS
ALANLESLEYLSLFGNNFEGFFSLGLLANLSKLKVLRLDSQSNSLEVEFETSWKPKFQLV
VIALRSCNLEKVPHFLLHQKDLHHVDLSDNQIHGNFPSWLLENNTKLEVLLLQNNSFTSF
QLPKSAHNLLFLNVSVNKFNHLFLQNFGWILPHLVCVNLAYNGFQGNLPSSLDNMKSIEF
LDLSHNRFHGKLPRRFLKGCYNLTILKLSHNKLSGEVFPEAANFTRLWVMSMDNNLFTGN
IGKGFRSLPSLNVLDISNNKLTGVIPSWIGERQGLFALQLSNNMLEGEIPTSLFNISYLQ
LLDLSSNRLSGDIPPHVSSIYHGAVLLLQNNNLSGVIPDTLLLNVIVLDLRNNRLSGNLP
EFINTQNISILLLRGNNFTGQIPHQFCSLSNIQLLDLSNNKFNGSIPSCLSNTSFGLRKG
DDSYRYDVPSRFGTAKDPVYFESLLMIDEFNMVNETNSQTKIEFATKHRYDAYMGGNLKL
LFGMDLSENELSGEIPVELGGLVELEALNLSHNNLSGVILESFSGLKNVESLDLSFNRLQ
GPIPLQLTDMISLAVFNVSYNNLSGIVPQGRQFNTFETQSYFGNPLLCGKSIDISCASNN
FHPTDNGVEADESTVDMESFYWSFVAAYVTILLGILASLSFDSPWSRAWFYIVDAFVLKV
RNMLWQNTAGTKCSYVLVSLSSPSVVVLLKPPALFHKTRT

MERKVFSGQNLIWVMLLLVQLRGYKCCIEKERKALLELKKYMISKTADWGLDSVLPTWTN
DTKSNCCRWEGLKCNQTSGRIIELSIGQTNFKESSLLNLSLLHPFEELRSLNLSGEIYNE
FNGLFDDVEGYESLRRLRNLEILDLSSNSFNNSIFPFLNAATSLTTLFIQSNYIGGPLPI
KELKNLTKLELLDLSRSGYNGSIPEFTHLEKLKALDLSANDFSSLVELQELKVLTNLEVL
GLAWNHLDGPIPKEVFCEMKNLRQLDLRGNYFEGQLPVCLGNLNKLRVLDLSSNQLSGNL
PASFNSLESLEYLSLSDNNFEGFFSLNPLANLTKLKVFRLSSTSEMLQVETESNWLPKFQ
LTVAALPFCSLGKIPNFLVYQTNLRLVDLSSNRLSGDIPTWLLENNPELKVLQLKNNSFT
IFQIPTIVHKLQVLDFSANDITGVLPDNIGHVLPRLLHMNGSHNGFQGNLPSSMGEMNDI
SFLDLSYNNFSGELPRSLLTGCFSLITLQLSHNSFSGPILPIQTRLTSLIVLRMHNNLFT
GEIGVGLRTLVNLSIFDASNNRLTGLISSSIPPDSSHLIMLLLSNNLLEGTLPPSLLAIH
HLNFLDLSGNLLSGDLPSSVVNSMYGIKIFLHNNSFTGPLPVTLLENAYILDLRNNKLSG
SIPQFVNTGKMITLLLRGNNLTGSIPRKLCDLTSIRLLDLSDNKLNGVIPPCLNHLSTEL
GEGIGLSGFSQEISFGDSLQMEFYRSTFLVDEFMLYYDSTYMIVEIEFAAKQRYDSFSGG
TLDYMYGLDLSSNELSGVIPAELGDLSKLRALNLSRNLLSSSIPANFSKLKDIESLDLSY
NMLQGNIPHQLTNLTSLAVFNVSFNNLSGIIPQGGQFNTFNDNSYLGNPLLCGTPTDRSC
EGKKNTKEADNGGEEEEEDDDDEAAIDMVVLYWTTGSTYAIALIGILVLMCFDCPWRRTW
LCIVDAFIASGKSMFS

Other information
Ka divergence:-0.0990282KaKs divergence:-0.329233
GC content 1 (%):40GC content 2 (%):41GC content divergence:0.012
Length 1 (bp):3003Length 2 (bp):2931Length divergence:-0.012
MFE 1 (kcal):-803.31MFE 2 (kcal):-804.04MFE divergence0