Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G75030-AT1G75040
Species:Arabidopsis
Duplication type:TD
Function (paralog1):thaumatin-like protein 3
Function (paralog2):pathogenesis-related gene 5

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-1.1872680329006
Log2 mRNA fold difference:0.0020218941498912
Log2 TE fold difference:-1.3020218568669
Sequences
Protein sequence

MAKISSIHILFFVFITSGIADSATVFTLQNSCAYTVWPGTLSGNSITLGDGGFPLTPGAS
VQLTAPTGWSGRFWARTGCNFDASGHGTCVTGDCGGVLKCTGGGVPPATLAEFTVGSSNA
GMDFYDVSLVDGYNVKMGIKPQGGFGNCKYAGCVSDINEICPSELRIMDPNSGSVAACKS
ACAAFSSPEFCCTGAHATPQTCSPTYYSSMFKNACPSAYSYAYDDASSTFTCTGSNYLIT
FCPTQS

MANISSIHILFLVFITSGIAVMATDFTLRNNCPTTVWAGTLAGQGPKLGDGGFELTPGAS
RQLTAPAGWSGRFWARTGCNFDASGNGRCVTGDCGGLRCNGGGVPPVTLAEFTLVGDGGK
DFYDVSLVDGYNVKLGIRPSGGSGDCKYAGCVSDLNAACPDMLKVMDQNNVVACKSACER
FNTDQYCCRGANDKPETCPPTDYSRIFKNACPDAYSYAYDDETSTFTCTGANYEITFCP

www.000webhost.com

Other information
Ka divergence:0.412244KaKs divergence:0.650298
GC content 1 (%):53GC content 2 (%):52GC content divergence:-0.01
Length 1 (bp):741Length 2 (bp):720Length divergence:-0.014
MFE 1 (kcal):-262.64MFE 2 (kcal):-234.67MFE divergence-0.056