Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G75280-AT1G75290
Species:Arabidopsis
Duplication type:TD
Function (paralog1):NmrA-like negative transcriptional regulator family protein
Function (paralog2):NAD(P)-binding Rossmann-fold superfamily protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-4.4191620127183
Log2 mRNA fold difference:-3.9372443144993
Log2 TE fold difference:-0.4172965319112
Sequences
Protein sequence

MATEKSKILVIGGTGYIGKFLVEASAKAGHSTFALVREATLSDPVKGKTVQSFKDLGVTI
LHGDLNDHESLVKAIKQVDVVISTVGSMQILDQTKIISAIKEAGNVKRFLPSEFGVDVDR
TSAVEPAKSAFAGKIQIRRTIEAEGIPYTYAVTGCFGGYYLPTLVQFEPGLTSPPRDKVT
ILGDGNAKAVINKEEDIAAYTIKAVDDPRTLNKILYIKPSNNTLSMNEIVTLWEKKIGKS
LEKTHLPEEQLLKSIQESPIPINVVLSINHAVFVNGDTNISIEPSFGVEASELYPDVKYT
SVDEYLSYFA

MASEKSKILVIGGTGHIGKLIIEASVKAGHSTLALVREASLSDPNKGKTVQNFKDFGVTL
LHGDLNDHESLVKAIKQADVVISTVGSMQILDQTKIISAIKEAGNVKRFLPSEFGMDVDK
SSAVEPAKSAFGRKLQTRRDIEAEGIPYTYLVTNYFAGYYLPTLVQLEPGLTSPPRDKVK
IFGDGNVKAVINKEEDIAAYTIKAVDDPRTLNKTLYINPPNNTLSMNEIVTLWEKKIGKS
VEKIYMSEEQIFKSIQESPVPFNVLLSINHAVFVKGDQTNFTIEPSFGFEASELYPDIKY
TSIDEYLSYFALGTSLNT

www.000webhost.com

Other information
Ka divergence:0.444055KaKs divergence:0.168736
GC content 1 (%):45GC content 2 (%):43GC content divergence:-0.023
Length 1 (bp):933Length 2 (bp):957Length divergence:0.013
MFE 1 (kcal):-291.81MFE 2 (kcal):-269.84MFE divergence-0.039