Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G75880-AT1G75890
Species:Arabidopsis
Duplication type:TD
Function (paralog1):SGNH hydrolase-type esterase superfamily protein
Function (paralog2):GDSL-like Lipase/Acylhydrolase superfamily protein

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:-0.99067002679439
Log2 mRNA fold difference:-0.69592283613303
Log2 TE fold difference:-0.19944762938587
Sequences
Protein sequence

MERCRSGHHRIISYYLSSSLILFWCIFVLVLLSTTSTTNALVKIPKNTTVPAVIVFGDSI
VDAGNNDDMITEARCDYAPYGIDFDGGVATGRFSNGKVPGDIVAEELGIKPNIPAYRNPN
LKPEELLTGVTFASGGAGYVPLTTKIAVGGIPLPQQLIYFEEYIEKLKQMVGEKRTKFII
KNSLFVVICGSNDIANDFFTLPPVRLHYTVASFTALMADNARSFAQTLYGYGARRILVFG
APPIGCVPSQRTVAGGPTRDCVARFNDAAKLFNTKLSANIDVLSRTLQDPTIIYIDIYSP
LLDLILNPHQYGFKVANKGCCGTGLIEVTALCNNYTASVCPIRSDYVFWDSFHPTEKAYR
IIVAKLLDRYLNRFF

MKRNSINIHHVTSFSSSPFWCVFFLVLLCKTSTNALVKQPPNETTPAIIVFGDSIVDAGN
NDDIMTTLARCNYPPYGIDFDGGIPTGRFCNGKVATDFIAGKFGIKPSIPAYRNPNLKPE
DLLTGVTFASGGAGYVPFTTQLSTYLFIYKPLLFLKGGIALSQQLKLFEEYVEKMKKMVG
EERTKLIIKNSLFMVICGSNDITNTYFGLPSVQQQYDVASFTTLMADNARSFAQKLHEYG
ARRIQVFGAPPVGCVPSQRTLAGGPTRNCVVRFNDATKLYNVKLAANLGSLSRTLGDKTI
IYVDIYDSLLDIILDPRQYGFKVVDKGCCGTGLIEVALLCNNFAADVCPNRDEYVFWDSF
HPTEKTYRIMATKYFERYV

www.000webhost.com

Other information
Ka divergence:0.301827KaKs divergence:0.406637
GC content 1 (%):40GC content 2 (%):39GC content divergence:-0.013
Length 1 (bp):1128Length 2 (bp):1140Length divergence:0.005
MFE 1 (kcal):-316.79MFE 2 (kcal):-294.73MFE divergence-0.036