Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G76640-AT1G76650
Species:Arabidopsis
Duplication type:TD
Function (paralog1):Calcium-binding EF-hand family protein
Function (paralog2):calmodulin-like 38

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:3.079623941855
Log2 mRNA fold difference:2.6226518709406
Log2 TE fold difference:0.35521512098682
Sequences
Protein sequence

MKNTQRQLSSSFMKFLEEKNRDLEAVFAYMDANRDGRISAEELKKSFKTLGEQMSDEEAE
AAVKLSDIDGDGMLDINEFALLIKGNDEFTEEEKKRKIMEAFRMYIADGEDCITPGSLKM
MLMKLGESRTTDDCKVMIQAFDLNADGVLSFDEFALMMR

MKNNTQPQSSFKKLCRKLSPKREDSAGEIQQHNSSNGEDKNRELEAVFSYMDANRDGRIS
PEELQKSFMTLGEQLSDEEAVAAVRLSDTDGDGMLDFEEFSQLIKVDDEEEKKMELKGAF
RLYIAEGEDCITPRSLKMMLKKLGESRTTDDCRVMISAFDLNADGVLSFDEFALMMR

www.000webhost.com

Other information
Ka divergence:-0.128341KaKs divergence:0.589554
GC content 1 (%):41GC content 2 (%):39GC content divergence:-0.025
Length 1 (bp):480Length 2 (bp):534Length divergence:0.053
MFE 1 (kcal):-124MFE 2 (kcal):-140.1MFE divergence0.061