Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G76680-AT1G76690
Species:Arabidopsis
Duplication type:TD
Function (paralog1):12-oxophytodienoate reductase 1
Function (paralog2):12-oxophytodienoate reductase 2

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-1.8075696348711
Log2 mRNA fold difference:-2.3707120210945
Log2 TE fold difference:0.54521533088598
Sequences
Protein sequence

MENGEAKQSVPLLTPYKMGRFNLSHRVVLAPLTRQRSYGNVPQPHAAIYYSQRTTPGGFL
ITEATGVSDTAQGYQDTPGIWTKEHVEAWKPIVDAVHAKGGIFFCQIWHVGRVSNSGFQP
NGKAPISCSDKPLMPQIRSNGIDEALFTPPRRLGIEEIPGIVNDFRLAARNAMEAGKHIL
DLEFKKLKPFKILICVLVVAGFDGVEIHGANGYLIDQFMKDTVNDRTDEYGGSLQNRCKF
PLEIVDAVAKEIGPDRVGIRLSPFADYMESGDTNPGALGLYMAESLNKYGILYCHVIEAR
MKTMGEVHACPHTLMPMRKAFKGTFISAGGFTREDGNEAVSKGRTDLVAYGRWFLANPDL
PKRFQVDAPLNKYDRPTFYTSDPVVGYTDYPFLESTA

MEMVNAEAKQSVPLLTPYKMGRFNLSHRVVLAPLTRQKSYGSVPQPHAILYYSQRTSPGG
FLIAEATGVSDTAQGYPDTPGIWTKEHVEAWKPIVDAVHAKGGIFFCQIWHVGRVSNRGF
QPRRQAPISCTGKPIMPQMRANGIDEARFTPPRRLSIEEIPGIVNDFRLAARNAMEAGFD
GVEIHGAHGYLIDQFMKDKVNDRTDEYGGSLQNRCKFALEVVDAVAKEIGPDRVGIRLSP
FADYMESGDTNPEALGLYMVESLNKYGILYCHMIEPRMKTVGEIAACSHTLMPMREAFKG
TFISAGGFTREDGNEAVAKGRTDLVAYGRWFLANPDLPKRFQLDAPLNKYNRSTFYTSDP
VVGYTDYPSLESTA

www.000webhost.com

Other information
Ka divergence:-0.185213KaKs divergence:0.125574
GC content 1 (%):45GC content 2 (%):46GC content divergence:0.011
Length 1 (bp):1194Length 2 (bp):1125Length divergence:-0.03
MFE 1 (kcal):-360.9MFE 2 (kcal):-353.44MFE divergence-0.01