Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G76720-AT1G76810
Species:Arabidopsis
Duplication type:TD
Function (paralog1):eukaryotic translation initiation factor 2 (eIF-2) family protein
Function (paralog2):eukaryotic translation initiation factor 2 (eIF-2) family protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:3.0785565780997
Log2 mRNA fold difference:3.5367456830237
Log2 TE fold difference:-0.38975153238873
Sequences
Protein sequence

MGRKKPSSSRGGDDEQPPAASSLVGAESKKKAVQSDEEDKYSINTEEEKVVITGKKKSNK
KVTQKHDDDDDFTEAVPENGFVGKKKKSKGKNRGGSVSFALLSGKEETDDNESNGDKDDE
PVISFTGKKNASNKGKKGFAVSAFDALGGDKDDEEVDGDEEQVSPITFSEGTMGDEESLE
ITFSGKKKGSIVLASLGDDSVADETSQAKTPDTKSVEVIETGKIKKKKKNKNKVARTLEE
EDDLDKLLAELGETPAAERPASSTPEVEKVQAQPGPVAPVENAGEKEGEKETVETAAAKK
KKKKKEKDKEKKAAAAATSSVEAKEEKQEESVTEPLQPKKKDAKGKAAEKKIPKHVREMQ
EALARRQEAEERKKKEEEEKLRKEEEERRRQEELEAQAEEAKRKRKEKEKEKLLRKKLEG
KLLTAKQKTEAQKREAFKNQLLAAGRGLPVADDVGDATSSKRPIYANKKKPSRQKGNDTS
VQVEDEVEPQENHAATLGEVGSEDTEKVDLLESANTGEKSGPADVAQENGVEEDDEWDAK
SWDNVDLKIDDKEEEAQPVVKKELKAHDSDHETEKPTAKPAGMSKLTTGAVKAISEVEDA
ATQTKRAKKGKCLAPSEFIKEGGENLRSIICCIMGHVDSGKTKLLDCIRGTNVQEGEAGG
ITQQIGATYFPAKNIRERTRELKADAKLKVPGLLVIDTPGHESFTNLRSRGSSLCDLAIL
VVDIKHGLEPQTIESLNLLRMRNTEFIIALNKVDRLYGWKTCKNAPIVKAMKQQNKDVTN
EFNIRLTDIITQFKEQGLNTEIYYKNKEMGETFSIVPTSAKSGEGVPDLLLWLVQWAQKT
MVEKLTYVDEVQCTVLEVKVIEGHGTTIDVVLVNGELHEGDQIVVCGLQGPIVTTIRALL
TPHPMKELRVKGTYLHHKEIKAAQGIKITAQGLEHAIAGTSLHVVGPDDDIEAMKESAME
DMESVLSRIDKSGEGVYVQTSTLGSLEALLEFLKTPAVNIPVSEGYNEGWSDAREEKEYA
TILAFDVKVTTEARELADEMGVKIFCADIIYQLFNQFQVYIENIKEEKKKESAGEAVFPC
VLQILPNCVFNKRDPIILGVKVHDGILKIGTPICVPGREFTDIGRIASIENNHKPVDYAE
KGDEVAIKIVASNREEQKMFGRHFDMEDELVSHISRRSIDILKADYMVSQG

MGRKKPSARGGDAEQQPPASSLVGATKSKKKGAQIDDDEYSIGTELSEESKVEEEKVVVI
TGKKKGKKGNKKGTQQDDDDDFSDKVSAAGVKDDVPEIAFVGKKKSKGKKGGGSVSFALL
DDEDEKEDNESDGDKDDEPVISFTGKKHASKKGKKGGNSFAASAFDALGSDDDDTEEVHE
DEEEESPITFSGKKKKSSKSSKKNTNSFTADLLDEEEGTDASNSRDDENTIEDEESPEVT
FSGKKKSSKKKGGSVLASVGDDSVADETKTSDTKNVEVVETGKSKKKKKNNKSGRTVQEE
EDLDKLLAALGETPAAERPASSTPVEEKAAQPEPVAPVENAGEKEGEEETAAAKKKKKKK
EKEKEKKAAAAAAATSSVEVKEEKQEESVTEPLQPKKKDAKGKAAEKKIPKHVREMQEAL
ARRQEAEERKKKEEEEKLRKEEEERRRQEELEAQAEEAKRKRKEKEKEKLLRKKLEGKLL
TAKQKTEAQKREAFKNQLLAAGGGLPVADNDGDATSSKRPIYANKKKSSRQKGIDTSVQG
EDEVEPKENQADEQDTLGEVGLTDTGKVDLIELVNTDENSGPADVAQENGVEEDDEEDEW
DAKSWGTVDLNLKGDFDDEEEEAQPVVKKELKDAISKAHDSEPEAEKPTAKPAGTGKPLI
AAVKATPEVEDATRTKRATRAKDASKKGKGLAPSESIEGEENLRSPICCIMGHVDTGKTK
LLDCIRGTNVQEGEAGGITQQIGATYFPAENIRERTKELKADAKLKVPGLLVIDTPGHES
FTNLRSRGSSLCDLAILVVDIMHGLEPQTIESLNLLRMRNTEFIVALNKVDRLYGWKTCK
NAPIVKAMKQQNKDVINEFNLRLKNIINEFQEQGLNTELYYKNKDMGDTFSIVPTSAISG
EGVPDLLLWLVQWAQKTMVEKLTYVDEVQCTVLEVKVIEGHGTTIDVVLVNGELHEGDQI
VVCGLQGPIVTTIRALLTPHPMKELRVKGTYLHYKEIKAAQGIKITAQGLEHAIAGTALH
VVGPDDDIEAIKESAMEDMESVLSRIDKSGEGVYVQASTLGSLEALLEYLKSPAVKIPVS
GIGIGPVHKKDVMKAGVMLERKKEYATILAFDVKVTTEARELADEMGVKIFCADIIYHLF
DLFKAYIENIKEEKKKESADEAVFPCVLQILPNCVFNKKDPIVLGVDVIEGILKIGTPIC
VPGREFIDIGRIASIENNHKPVDYAKKGNKVAIKIVGSNAEEQKMFGRHFDMEDELVSHI
SRRSIDILKSNYRDELSLEEWKLVVKLKNIFKIQ

www.000webhost.com

Other information
Ka divergence:-0.368599KaKs divergence:-0.412694
GC content 1 (%):43GC content 2 (%):43GC content divergence:0
Length 1 (bp):3576Length 2 (bp):3885Length divergence:0.041
MFE 1 (kcal):-1037MFE 2 (kcal):-1106.29MFE divergence0.032