Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G77145-AT1G77160
Species:Arabidopsis
Duplication type:TD
Function (paralog1):Protein of unknown function (DUF506)
Function (paralog2):Protein of unknown function (DUF506)

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:-1.7447646635698
Log2 mRNA fold difference:-1.6809383187048
Log2 TE fold difference:-0.043843125200069
Sequences
Protein sequence

MGSLGEEDLEKLVLDYIESPITVSQHIESSTTALITLKEILRAKGEKEKEMEEKIWSFIN
GGRLSYEGDDEKRDVMNKIVSKLRSEGYDASLSKTSWDSSFDHREGCRVFRCSRKYEYID
VMVKGDSNRDGVSKLKRVIIDLDFKTQFELARQTEAYKDMTEMLPLVFVATEGRLRRVVS
LVCGEMKKSMKKEGMSRPPWRTTRYMQSKWLPENRRRVSGCKKGSWSWSVFDDGSEGRGE
ARTWTVSGSGPKTKCCFPIF

MGSLGEEDFEKLVLGYIESPMTVSQHINTSSKALITLQEIFLQEILRAKGVEEKEMEEKI
RSYINRGRLSYEGDDEKRDVMNKIVSKLRSEGYNASLSKTSWDSSFDHREGCRVFTCSRK
YEYIDAMVIGDSDRDGVSKLKRVIIDLDFKTQFELARQTEAYKDMTEMLPTVFVATEGRL
RRVVSLVCGEMKKSMKKEGMSRPPWRTSRYMQSKWLPENCRRDAGCKKGSWSWSVFDDGG
EGIGEARSWTVSGPKTKCCFPIF

www.000webhost.com

Other information
Ka divergence:0.192692KaKs divergence:0.999492
GC content 1 (%):43GC content 2 (%):43GC content divergence:0
Length 1 (bp):783Length 2 (bp):792Length divergence:0.006
MFE 1 (kcal):-233.52MFE 2 (kcal):-229.56MFE divergence-0.009