Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G77990-AT1G78000
Species:Arabidopsis
Duplication type:TD
Function (paralog1):STAS domain / Sulfate transporter family
Function (paralog2):sulfate transporter 1;2

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:0.070922163604814
Log2 mRNA fold difference:-0.1667219333886
Log2 TE fold difference:0.15814278864908
Sequences
Protein sequence

MQLSSLSHTSITHKDKKKKMGIELQNHQSHHEEASPAEEPMSRWLINTPEPPSMWQELIG
YIRTNVLAKKKHKRNKTKNSSSNLVYSCLKSAFPILSWGRQYKLNLFKKDLMAGLTLASL
CIPQSIGYANLAGLDPEYGLYTSVVPPLIYSTMGTSRELAIGPVAVVSLLLSSMVRDLQD
PVTDPIAYRKIVFTVTFFAGAFQAIFGLFRLGFLVDFLSHAALVGFMAGAAIVIGLQQLK
GLFGLTHFTNKTDVVSVLSSVFHSLHHPWQPLNFVIGSSFLIFILLARFIGKRNNKLFWI
PAMAPLISVVLATLIVYLSNAESRGVKIVKHIKPGFNQLSVNQLQFKSPHLGQIAKIGLI
SAIIALTEAIAVGRSFATIKGYRLDGNKEMMAMGFMNIAGSLSSCYVATGSFSRTAVNFS
AGCETVVSNIVMAITVMISLEVLTRFLYFTPTAILASIILSALPGLIDVSGALHIWKLDK
LDFLVLIAAFFGVLFASVEIGLLLAVGISFARIMLSSIRPSIEALGRLSKTDIFGDINQY
PMANKTAGLLTLRISSPLLCFANANFIRDRILNSVQEIEGEENEQEVLKENGLQVVILDM
SCVMGVDTSGVFALEELHQELASNDIRLVIASPRWRVLHKLKRAKLDEKIKTENIYMTVG
EAVDIYVRARSTSHELC

MSSRAHPVDGSPATDGGHVPMKPSPTRHKVGIPPKQNMFKDFMYTFKETFFHDDPLRDFK
DQPKSKQFMLGLQSVFPVFDWGRNYTFKKFRGDLISGLTIASLCIPQDIGYAKLANLDPK
YGLYSSFVPPLVYACMGSSRDIAIGPVAVVSLLLGTLLRAEIDPNTSPDEYLRLAFTATF
FAGITEAALGFFRLGFLIDFLSHAAVVGFMGGAAITIALQQLKGFLGIKKFTKKTDIISV
LESVFKAAHHGWNWQTILIGASFLTFLLTSKIIGKKSKKLFWVPAIAPLISVIVSTFFVY
ITRADKQGVQIVKHLDQGINPSSFHLIYFTGDNLAKGIRIGVVAGMVALTEAVAIGRTFA
AMKDYQIDGNKEMVALGMMNVVGSMSSCYVATGSFSRSAVNFMAGCQTAVSNIIMSIVVL
LTLLFLTPLFKYTPNAILAAIIINAVIPLIDIQAAILIFKVDKLDFIACIGAFFGVIFVS
VEIGLLIAVSISFAKILLQVTRPRTAVLGNIPRTSVYRNIQQYPEATMVPGVLTIRVDSA
IYFSNSNYVRERIQRWLHEEEEKVKAASLPRIQFLIIEMSPVTDIDTSGIHALEDLYKSL
QKRDIQLILANPGPLVIGKLHLSHFADMLGQDNIYLTVADAVEACCPKLSNEV

www.000webhost.com

Other information
Ka divergence:0.262373KaKs divergence:0.150418
GC content 1 (%):42GC content 2 (%):44GC content divergence:0.023
Length 1 (bp):2034Length 2 (bp):1962Length divergence:-0.018
MFE 1 (kcal):-594.45MFE 2 (kcal):-592.09MFE divergence-0.002