Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G78820-AT1G78830
Species:Arabidopsis
Duplication type:TD
Function (paralog1):D-mannose binding lectin protein with Apple-like carbohydrate-binding domain
Function (paralog2):Curculin-like (mannose-binding) lectin family protein

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:-0.40074666603158
Log2 mRNA fold difference:-0.6107070455334
Log2 TE fold difference:0.19243881861837
Sequences
Protein sequence

MLRFDYLLITALAISTVSVVMAQVPPEKQFRVLNEPGYAPYITEYDASYRFLNSPNQNFF
TIPFQLMFYNTTPSAYVLALRVGTRRDMSFTRWIWDANRNNPVGDNSTLSFGRNGNLVLA
ELNGQVKWQTNTANKGVTGFQILPNGNMVLHDKHGKFVWQSFDHPTDTLLVGQSLKVNGV
NKLVSRTSDMNGSDGPYSMVLDNKGLTMYVNKTGTPLVYGGWTDHDFRGTVTFAVTREFD
NLTEPSAYELLLEPAPQPATNPGNNRRLLQVRPIGSGGGTLNLNKINYNGTISYLRLGSD
GSLKAFSYFPAATYLEWEETFAFFSNYFVRQCGLPTFCGDYGYCDRGMCVGCPTPKGLLA
WSDKCAPPKTTQFCSGGKGKAVNYYKIVGVEHFTGPYVNDGQGPTSVNDCKAKCDRDCKC
LGYFYKEKDKKCLLAPLLGTLIKDANTSSVAYIKY

MSRFAILVTLALAIATVSVVIAQVPPEKQFRVVNEGEFGEYITEYDASYRFIESSNQSFF
TSPFQLLFYNTTPSAYILALRVGLRRDESTMRWIWDANRNNPVGENATLSLGRNGNLVLA
EADGRVKWQTNTANKGVTGFQILPNGNIVLHDKNGKFVWQSFDHPTDTLLTGQSLKVNGV
NKLVSRTSDSNGSDGPYSMVLDKKGLTMYVNKTGTPLVYGGWPDHDFRGTVTFAVTREFD
NLTEPSAYELLLEPAPQPATNPGNNRRLLQVRPIGSGGGTLNLNKINYNGTISYLRLGSD
GSLKAYSYFPAATYLKWEESFSFFSTYFVRQCGLPSFCGDYGYCDRGMCNACPTPKGLLG
WSDKCAPPKTTQFCSGVKGKTVNYYKIVGVEHFTGPYVNDGQGPTSVNDCKAKCDRDCKC
LGYFYKEKDKKCLLAPLLGTLIKDANTSSVAYIKY

www.000webhost.com

Other information
Ka divergence:-0.287928KaKs divergence:0.999793
GC content 1 (%):48GC content 2 (%):47GC content divergence:-0.011
Length 1 (bp):1368Length 2 (bp):1368Length divergence:0
MFE 1 (kcal):-426.12MFE 2 (kcal):-415.97MFE divergence-0.012