Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G79360-AT1G79410
Species:Arabidopsis
Duplication type:TD
Function (paralog1):organic cation/carnitine transporter 2
Function (paralog2):organic cation/carnitine transporter5

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:2.2828783115237
Log2 mRNA fold difference:1.4541293410307
Log2 TE fold difference:0.60895161212093
Sequences
Protein sequence

MAEPTQPLLTDSNSSSPRSLDDTIESYIGSFGWAQFLQAALVSFSGVFDAQQTFISVFTD
SEPTWHCTDSNSICHESISNICILPKTAWSWDYSPHVSVISEWGLQCAGSFVKGLPESSF
FVGCLIGGLVLSTLADSSLGRKNMLFLSCLVMAISTMLTVFSPNIWVYAVLRFVNGFGRA
TIGTCALVLSTELVGKKWRGRVGIMSFFGFMLGFLSLPLMAYMNRGSSWRILYAWTSIPT
IIYCVLVRFFVCESPRWLFVRGRREEAISILKRVASIPSTDVSSGGAISMSFSSLPFEED
EEKPSTNVNIFTTMKVLVEKRWALKRLSAVMAIAFGIGLVYYGMPLALSNLDFNIYLSAA
FNALMDLPANLITLFLVDKLSRRNALIGFTALGGVSSVLIFALHNMRIGNHGALQLALEL
ISYFSACSAFNMEMIYTIELFPTCVRNSAIAMARQALVLGGVFSPIMVAAGRKNAFWSFG
LFGLAIGLLGLFAVGLPETRGSDLCDTMDEEECKDRRSKVAVNNVIA

MADSLAPLLPTHIEEDEDTSSPLTFDKILEKSLSDFGFSQFLQIVLVGLALTFDSQQIFI
TVFTDAYPTWHCLDHTICNPATTDICKIPRSAWDWDGGFKGKSVISEFDLECSSSFLRSL
PSSTFYVGSIVGGVVLAMIPDGSLGRKQLLFFSSFAMSLTGISIFLSSNIWIYSFLKFVI
GFARSQTGTYALVLISERISTKWRPRATMVPFTLFVLGFMSLSGIAYLVRHASWKVLYLC
TSIPAGIHSIFIYFFALESPRWLHLEGKNKEAIEVLKRISPANRGYLESVSSRLRPKETL
EQTSSYSIKDLFIIKWAFRRVTLVMIIMFGLGMSYYGVPLAVRDIKVNIYMSEALNAMVE
LPTFVVTPILLEQFSRRSSVLVNCLIGGASGVLCFVMSLYGRTKIAFALELGSFFCARIG
FNLMAIYLVELFPTCVRNSATMMLRQALVVGGACCPLIASLGRNVPSLSFAVFGFAMSGL
GLFALLLPETKGLSLCDTMEEQEQRDQALKTSHSC

Other information
Ka divergence:0.553837KaKs divergence:0.324553
GC content 1 (%):45GC content 2 (%):44GC content divergence:-0.011
Length 1 (bp):1584Length 2 (bp):1548Length divergence:-0.011
MFE 1 (kcal):-505.22MFE 2 (kcal):-464.88MFE divergence-0.042