Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G79920-AT1G79930
Species:Arabidopsis
Duplication type:TD
Function (paralog1):Heat shock protein 70 (Hsp 70) family protein
Function (paralog2):heat shock protein 91

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:-0.60623488356544
Log2 mRNA fold difference:-0.69381420254986
Log2 TE fold difference:0.087371780494984
Sequences
Protein sequence

MSVVGFDFGNENCLVAVARQRGIDVVLNDESNRETPAIVCFGDKQRFIGTAGAASTMMNP
KNSISQIKRLIGRQFSDPELQRDIKSLPFSVTEGPDGYPLIHANYLGEIRAFTPTQVMGM
MLSNLKGIAEKNLNTAVVDCCIGIPVYFTDLQRRAVLDAATIAGLHPLHLIHETTATALA
YGIYKTDLPENDQLNVAFIDIGHASMQVCIAGFKKGQLKILSHAFDRSLGGRDFDEVLFN
HFAAKFKDEYKIDVSQNAKASLRLRATCEKLKKVLSANPMAPLNIECLMAEKDVRGVIKR
EEFEEISIPILERVKRPLEKALSDAGLTVEDVHMVEVVGSGSRVPAMIKILTEFFGKEPR
RTMNASECVSRGCALQCAILSPTFKVREFQVHESFPFSISLAWKGAATDAQNGGTENQQS
TIVFPKGNPIPSVKALTFYRSGTFSIDVQYSDVNDLQAPPKISTYTIGPFQSSKGERAKL
KVKVRLNLHGIVSVESATLLEEEEVEVSVTKDQSEETAKMDTDKASAEAAPASGDSDVNM
QDAKDTSDATGTDNGVPESAEKPVQMETDSKAEAPKKKVKKTNVPLSELVYGALKTVEVE
KAVEKEFEMALQDRVMEETKDRKNAVESYVYDMRNKLSDKYQEYITDSEREAFLANLQEV
EDWLYEDGEDETKGVYVAKLEELKKVGDPVEVRYKESLERGSVIDQLGYCINSYREAAVS
NDPKFDHIELAEKQKVLNECVEAEAWLREKQQQQDTLPKYATPALLSADVKSKAEALDKF
CRPIMTKPKPAAKAEAPQAKGGEQADEGKSEPEQPASAEAMETENPAEGST

MSVVGFDFGNENCLVAVARQRGIDVVLNDESNRETPAIVCFGDKQRFIGTAGAASTMMNP
KNSISQIKRLIGRQFSDPELQRDIKSLPFSVTEGPDGYPLIHANYLGEKRAFTPTQVMGM
MLSNLKGIAEKNLNTAVVDCCIGIPVYFTDLQRRAVLDAATIAGLHPLRLIHETTATALA
YGIYKTDLPESDQLNVAFIDIGHASMQVCIAGFKKGQLKILSHAFDRSLGGRDFDEVLFN
HFAAKFKDEYKIDVSQNAKASLRLRATCEKLKKVLSANPLAPLNIECLMDEKDVRGVIKR
EEFEEISIPILERVKRPLEKALSDAGLTVEDVHMVEVIGSGSRVPAMIKILTEFFGKEPR
RTMNASECVSRGCALQCAILSPTFKVREFQVHESFPFSISLAWKGAASEAQNGGAENQQS
TIVFPKGNPIPSVKALTFYRSGTFSVDVQYSDVNDLQAPPKISTYTIGPFQSSKGERAKL
KVKVRLNLHGIVSVESATLLEEEEVEVPVTKEHSEETTKMDSDKASAEAAPASGDCDVNM
QDAKDTSDATGTDNGVPESAEKPVQMETDSKAEAPKKKVKKTNVPLSELVYGALKTVEVE
KAVEKEFEMALQDRVMEETKDRKNAVESYVYDMRNKLSDKYQEYITDSEREAFLANLQEV
EDWLYEDGEDETKGVYVAKLEELKKVGDPVEVRYKESLERGSVIDQLGYCINSYREAAMS
TDPKFDHIELAEKQKVLNECVEAEAWLRGKQQQQDTLPKYATPALLSADVKSKAEALDKF
CRPIMTKPKPVAKAEAPQAKGGEQADEGKSEPEQPASAEPMETENPAEGST

www.000webhost.com

Other information
Ka divergence:0.0305281KaKs divergence:0.422222
GC content 1 (%):46GC content 2 (%):46GC content divergence:0
Length 1 (bp):2496Length 2 (bp):2496Length divergence:0
MFE 1 (kcal):-830MFE 2 (kcal):-828.86MFE divergence-0.001