Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G80555-AT1G80560
Species:Arabidopsis
Duplication type:TD
Function (paralog1):Isocitrate/isopropylmalate dehydrogenase family protein
Function (paralog2):isopropylmalate dehydrogenase 2

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:0.85295317269258
Log2 mRNA fold difference:5.1380036060193
Log2 TE fold difference:-4.2349202258705
Sequences
Protein sequence

MAGVIHVSSTQIPVAFMSATKQSFRRASVIRCAANTPKKRYTIAVLPGDGVGNEVIPVAV
DVLCLAGSLEGIDFSFEELPIGGVALDLVGVPLPKETLIRAKQSDALLLGAVGWYGIITI
TFVHLKFGFI

MAAALQTNIRTVKVPATFRAVSKQSLAPFRVRCAVASPGKKRYTITLLPGDGIGPEVVSI
AKNVLQQAGSLEGVEFNFREMPIGGAALDLVGVPLPEETISAAKESDAVLLGAIGGYKWD
NNEKHLRPEKGLLQIRAALKVFANLRPATVLPQLVDASTLKREVAEGVDLMVVRELTGGI
YFGEPRGIKTNENGEEVGFNTEVYAAHEIDRIARVAFETARKRRGKLCSVDKANVLEASI
LWRKRVTALASEYPDVELSHMYVDNAAMQLVRDPKQFDTIVTNNIFGDILSDEASMITGS
IGMLPSASLSDSGPGLFEPIHGSAPDIAGQDKANPLATILSAAMLLKYGLGEEKAAKRIE
DAVLVALNNGFRTGDIYSAGTKLVGCKEMGEEVLKSVDSQVPASV

www.000webhost.com

Other information
Ka divergence:-0.529014KaKs divergence:-0.334434
GC content 1 (%):48GC content 2 (%):47GC content divergence:-0.011
Length 1 (bp):393Length 2 (bp):1218Length divergence:0.512
MFE 1 (kcal):-135.23MFE 2 (kcal):-398MFE divergence0.493