Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G02000-AT2G02010
Species:Arabidopsis
Duplication type:TD
Function (paralog1):glutamate decarboxylase 3
Function (paralog2):glutamate decarboxylase 4

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:-0.63718066537743
Log2 mRNA fold difference:-1.9569293037255
Log2 TE fold difference:1.3488516252037
Sequences
Protein sequence

MVLSKTASKSDDSIHSTFASRYVRNSISRFEIPKNSIPKEAAYQIINDELKFDGNPRLNL
ASFVTTWMEPECDKLMMESINKNNVEMDQYPVTTDLQNRCVNMIARLFNAPLGDGEAAIG
VGTVGSSEAVMLAGLAFKRQWQNKRKALGLPYDRPNIVTGANIQVCLEKFARYFEVELKE
VKLREGYYVMDPDKAVEMVDENTICVVAILGSTLTGEFEDVKLLNDLLVEKNKKTGWDTP
IHVDAASGGFIAPFLYPDLEWDFRLPLVKSINVSGHKYGLVYAGIGWVVWRTKTDLPDEL
IFHINYLGADQPTFTLNFSKGSSQVIAQYYQLIRLGFEGYRNVMDNCRENMMVLRQGLEK
TGRFNIVSKENGVPLVAFSLKDSSRHNEFEVAEMLRRFGWIVPAYTMPADAQHVTVLRVV
IREDFSRTLAERLVADFEKVLHELDTLPARVHAKMASGKVNGVKKTPEETQREVTAYWKK
FVDTKTDKNGVPLVASITNQ

MVLSKTVSESDVSIHSTFASRYVRNSLPRFEMPENSIPKEAAYQIINDELMLDGNPRLNL
ASFVTTWMEPECDKLMMESINKNYVDMDEYPVTTELQNRCVNMIARLFNAPLGDGEAAVG
VGTVGSSEAIMLAGLAFKRQWQNKRKAQGLPYDKPNIVTGANVQVCWEKFARYFEVELKE
VNLREDYYVMDPVKAVEMVDENTICVAAILGSTLTGEFEDVKLLNDLLVEKNKQTGWDTP
IHVDAASGGFIAPFLYPELEWDFRLPLVKSINVSGHKYGLVYAGIGWVVWRTKTDLPDEL
IFHINYLGADQPTFTLNFSKGSSQVIAQYYQLIRLGFEGYRNVMDNCRENMMVLRQGLEK
TGRFKIVSKENGVPLVAFSLKDSSRHNEFEVAHTLRRFGWIVPAYTMPADAQHVTVLRVV
IREDFSRTLAERLVADFEKVLHELDTLPARVHAKMANGKVNGVKKTPEETQREVTAYWKK
LLETKKTNKNTIC

www.000webhost.com

Other information
Ka divergence:-0.52162KaKs divergence:-0.432515
GC content 1 (%):47GC content 2 (%):47GC content divergence:0
Length 1 (bp):1503Length 2 (bp):1482Length divergence:-0.007
MFE 1 (kcal):-476.2MFE 2 (kcal):-494.37MFE divergence0.019