Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G02020-AT2G02040
Species:Arabidopsis
Duplication type:TD
Function (paralog1):Major facilitator superfamily protein
Function (paralog2):peptide transporter 2

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:2.6824853265497
Log2 mRNA fold difference:2.9710286967966
Log2 TE fold difference:-0.32662340535407
Sequences
Protein sequence

MASIDEERSLLEVEESLIQEEVKLYAEDGSIDIHGNPPLKQTTGNWKACPFIFANECCER
LAYYGIAKNLITYFTNELHETNVSAARHVMTWQGTCYITPLIGALIADAYWGRYWTIACF
SAIYFTGMVALTLSASVPGLKPAECIGSLCPPATMVQSTVLFSGLYLIALGTGGIKPCVS
SFGADQFDKTDPSERVRKASFFNWFYFTINIGAFVSSTVLVWIQENYGWELGFLIPTVFM
GLATMSFFFGTPLYRFQKPRGSPITSVCQVLVAAYRKSNLKVPEDSTDEGDANTNPWKLC
TVTQVEEVKILLRLVPIWASGIIFSVLHSQIYTLFVQQGRCMKRTIGLFEIPPATLGMFD
TASVLISVPIYDRVIVPLVRRFTGLAKGFTELQRMGIGLFVSVLSLTFAAIVETVRLQLA
RDLDLVESGDIVPLNIFWQIPQYFLMGTAGVFFFVGRIEFFYEQSPDSMRSLCSAWALLT
TTLGNYLSSLIITLVAYLSGKDCWIPSDNINNGHLDYFFWLLVSLGSVNIPVFVFFSVKY
THMKV

MGSIEEEARPLIEEGLILQEVKLYAEDGSVDFNGNPPLKEKTGNWKACPFILGNECCERL
AYYGIAGNLITYLTTKLHQGNVSAATNVTTWQGTCYLTPLIGAVLADAYWGRYWTIACFS
GIYFIGMSALTLSASVPALKPAECIGDFCPSATPAQYAMFFGGLYLIALGTGGIKPCVSS
FGADQFDDTDSRERVRKASFFNWFYFSINIGALVSSSLLVWIQENRGWGLGFGIPTVFMG
LAIASFFFGTPLYRFQKPGGSPITRISQVVVASFRKSSVKVPEDATLLYETQDKNSAIAG
SRKIEHTDDCQYLDKAAVISEEESKSGDYSNSWRLCTVTQVEELKILIRMFPIWASGIIF
SAVYAQMSTMFVQQGRAMNCKIGSFQLPPAALGTFDTASVIIWVPLYDRFIVPLARKFTG
VDKGFTEIQRMGIGLFVSVLCMAAAAIVEIIRLHMANDLGLVESGAPVPISVLWQIPQYF
ILGAAEVFYFIGQLEFFYDQSPDAMRSLCSALALLTNALGNYLSSLILTLVTYFTTRNGQ
EGWISDNLNSGHLDYFFWLLAGLSLVNMAVYFFSAARYKQKKASS

Other information
Ka divergence:-0.347825KaKs divergence:-0.333966
GC content 1 (%):42GC content 2 (%):45GC content divergence:0.034
Length 1 (bp):1638Length 2 (bp):1758Length divergence:0.035
MFE 1 (kcal):-476.77MFE 2 (kcal):-543.96MFE divergence0.066