Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G02380-AT2G02390
Species:Arabidopsis
Duplication type:TD
Function (paralog1):glutathione S-transferase (class zeta) 2
Function (paralog2):glutathione S-transferase zeta 1

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:5.0251474619888
Log2 mRNA fold difference:5.2953784171508
Log2 TE fold difference:-0.23158138816568
Sequences
Protein sequence

MSYVTDFYQAKLKLYSYWRSSCAHRVRIALTLKGLDYEYIPVNLLKGDQSDSDFKKINPM
GTVPALVDGDVVINDSFAIIMYLDDKYPEPPLLPSDYHKRAVNYQATSIVMSGIQPHQNM
ALFRYLEDKINAEEKTAWITNAITKGFTALEKLLVSCAGKYATGDEVYLADLFLAPQIHA
AFNRFHINMEPFPTLARFYESYNELPAFQNAVPEKQPDTPSTI

MANSGEEKLKLYSYWRSSCAHRVRIALALKGLDYEYIPVNLLKGDQFDSVYRFDLQDFKK
INPMGTVPALVDGDVVINDSFAIIMYLDEKYPEPPLLPRDLHKRAVNYQAMSIVLSGIQP
HQNLAVIRYIEEKINVEEKTAWVNNAITKGFTALEKLLVNCAGKHATGDEIYLADLFLAP
QIHGAINRFQINMEPYPTLAKCYESYNELPAFQNALPEKQPDAPSSTI

www.000webhost.com

Other information
Ka divergence:0.129522KaKs divergence:-0.304978
GC content 1 (%):43GC content 2 (%):43GC content divergence:0
Length 1 (bp):672Length 2 (bp):687Length divergence:0.011
MFE 1 (kcal):-182.04MFE 2 (kcal):-190.44MFE divergence0.023