Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G04040-AT2G04050
Species:Arabidopsis
Duplication type:TD
Function (paralog1):MATE efflux family protein
Function (paralog2):MATE efflux family protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:0.39048320839528
Log2 mRNA fold difference:-0.93578379594008
Log2 TE fold difference:1.4143703830395
Sequences
Protein sequence

MEEPFLLRDELLVPSQVTWHTNPLTVELKRVSRLAAPMATVTIAQYLLPVISVMVAGHNG
ELQLSGVALANSFTNVTGFSIMCGLVGALETLCGQAYGAKQYEKIGTYAYSAIASNIPIC
FLISILWLYIEKILISLGQDPEISRIAGSYAFWLIPALFGQAIVIPLSRFLLTQGLVIPL
LFTAVTTLLFHVLVCWTLVFLFGLGCNGPAMATSVSFWFYAVILSCYVRFSSSCEKTRGF
VSRDFVSSIKQFFQYGIPSAAMICLEWWLFEILILCSGLLPNPKLETSVLSICLTIETLH
YVISAGVAAAVSTRVSNNLGAGNPQVARVSVLAGLCLWIVESAFFSILLFTCRNIIGYAF
SNSKEVLDYVADLTPLLCLSFILDGFTAVLNGVARGSGWQHIGAWNNTVSYYLVGAPVGI
YLAFSRELNGKGLWCGVVVGSTVQATILAIVTASINWKEQAEKARKRIVSTENRLA

MEEPFLLQDEHLVPCKDTWKSGQVTVELKKVSSLAAPMAAVTIAQYLLPVISVMVAGHNG
ELQLSGVALATSFTNVSGFSILFGLAGALETLCGQAYGAKQYEKIGTYTYSATASNIPIC
VLISVLWIYIEKLLISLGQDPDISRVAGSYALWLIPALFAHAFFIPLTRFLLAQGLVLPL
LYCTLTTLLFHIPVCWAFVYAFGLGSNGAAMAISVSFWFYVVILSCYVRYSSSCDKTRVF
VSSDFVSCIKQFFHFGVPSAAMVCLEWWLFELLILCSGLLPNPKLETSVLSICLTTASLH
YVIPGGVAAAVSTRVSNKLGAGIPQVARVSVLAGLCLWLVESAFFSTLLFTCRNIIGYAF
SNSKEVVDYVANLTPLLCLSFILDGFTAVLNGVARGSGWQHIGALNNVVAYYLVGAPVGV
YLAFNRELNGKGLWCGVVVGSAVQAIILAFVTASINWKEQAEKARKRMVSSENRLA

Other information
Ka divergence:-0.351507KaKs divergence:-0.246921
GC content 1 (%):45GC content 2 (%):47GC content divergence:0.022
Length 1 (bp):1431Length 2 (bp):1431Length divergence:0
MFE 1 (kcal):-449.14MFE 2 (kcal):-459.87MFE divergence0.012