Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G12200-AT2G12280
Species:Arabidopsis
Duplication type:TD
Function (paralog1):P-loop containing nucleoside triphosphate hydrolases superfamily protein
Function (paralog2):P-loop containing nucleoside triphosphate hydrolases superfamily protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:2.3226414808961
Log2 mRNA fold difference:2.7195951032519
Log2 TE fold difference:-0.27738018196319
Sequences
Protein sequence

MYTQQGFSNLPICMSKTQYSFSHDTSKKRAPSGFVLPIRDVRGSIGAGFIYTTKKTVNPL
AGM

MYTQQGFSNLPICMSKTQYSFSHDASKKGAPSGFVLPIRDVRGSIGAGFIYPLVGTMSTM
PGLPTRPCFYEIDISQSFKASLHRRSSLPQ

Other information
Ka divergence:-1KaKs divergence:-0.999689
GC content 1 (%):40GC content 2 (%):43GC content divergence:0.036
Length 1 (bp):192Length 2 (bp):273Length divergence:0.174
MFE 1 (kcal):-43.3MFE 2 (kcal):-66.7MFE divergence0.213