Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G13790-AT2G13800
Species:Arabidopsis
Duplication type:TD
Function (paralog1):somatic embryogenesis receptor-like kinase 4
Function (paralog2):somatic embryogenesis receptor-like kinase 5

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.98650328635726
Log2 mRNA fold difference:-0.58185235895879
Log2 TE fold difference:-0.29208038222669
Sequences
Protein sequence

MTSSKMEQRSLLCFLYLLLLFNFTLRVAGNAEGDALTQLKNSLSSGDPANNVLQSWDATL
VTPCTWFHVTCNPENKVTRVDLGNAKLSGKLVPELGQLLNLQYLELYSNNITGEIPEELG
DLVELVSLDLYANSISGPIPSSLGKLGKLRFLRLNNNSLSGEIPMTLTSVQLQVLDISNN
RLSGDIPVNGSFSLFTPISFANNSLTDLPEPPPTSTSPTPPPPSGGQMTAAIAGGVAAGA
ALLFAVPAIAFAWWLRRKPQDHFFDVPAEEDPEVHLGQLKRFTLRELLVATDNFSNKNVL
GRGGFGKVYKGRLADGNLVAVKRLKEERTKGGELQFQTEVEMISMAVHRNLLRLRGFCMT
PTERLLVYPYMANGSVASCLRERPEGNPALDWPKRKHIALGSARGLAYLHDHCDQKIIHR
DVKAANILLDEEFEAVVGDFGLAKLMNYNDSHVTTAVRGTIGHIAPEYLSTGKSSEKTDV
FGYGVMLLELITGQKAFDLARLANDDDIMLLDWVKEVLKEKKLESLVDAELEGKYVETEV
EQLIQMALLCTQSSAMERPKMSEVVRMLEGDGLAERWEEWQKEEMPIHDFNYQAYPHAGT
DWLIPYSNSLIENDYPSGPR

MEHGSSRGFIWLILFLDFVSRVTGKTQVDALIALRSSLSSGDHTNNILQSWNATHVTPCS
WFHVTCNTENSVTRLDLGSANLSGELVPQLAQLPNLQYLELFNNNITGEIPEELGDLMEL
VSLDLFANNISGPIPSSLGKLGKLRFLRLYNNSLSGEIPRSLTALPLDVLDISNNRLSGD
IPVNGSFSQFTSMSFANNKLRPRPASPSPSPSGTSAAIVVGVAAGAALLFALAWWLRRKL
QGHFLDVPAEEDPEVYLGQFKRFSLRELLVATEKFSKRNVLGKGRFGILYKGRLADDTLV
AVKRLNEERTKGGELQFQTEVEMISMAVHRNLLRLRGFCMTPTERLLVYPYMANGSVASC
LRERPEGNPALDWPKRKHIALGSARGLAYLHDHCDQKIIHLDVKAANILLDEEFEAVVGD
FGLAKLMNYNDSHVTTAVRGTIGHIAPEYLSTGKSSEKTDVFGYGVMLLELITGQKAFDL
ARLANDDDIMLLDWVKEVLKEKKLESLVDAELEGKYVETEVEQLIQMALLCTQSSAMERP
KMSEVVRMLEGDGLAERWEEWQKEEMPIHDFNYQAYPHAGTDWLIPYSNSLIENDYPSGP
R

www.000webhost.com

Other information
Ka divergence:0.472548KaKs divergence:0.0295611
GC content 1 (%):44GC content 2 (%):44GC content divergence:0
Length 1 (bp):1863Length 2 (bp):1806Length divergence:-0.016
MFE 1 (kcal):-566.31MFE 2 (kcal):-542.31MFE divergence-0.022