Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G14520-AT4G33700
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):CBS domain-containing protein with a domain of unknown function (DUF21)
Function (paralog2):CBS domain-containing protein with a domain of unknown function (DUF21)

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:1.4792569372463
Log2 mRNA fold difference:2.3552120394675
Log2 TE fold difference:-0.84554594529674
Sequences
Protein sequence

MAVEYECCGTSFFIHIAVIVLLVLFAGLMSGLTLGLMSMSLVDLEVLAKSGTPRDRIHAA
KILPVVKNQHLLLCTLLICNAAAMEALPIFLDALVTAWGAILISVTLILLFGEIIPQSVC
SRHGLAIGATVAPFVRVLVWICLPVAWPISKLLDFLLGHGRVALFRRAELKTLVDLHGNE
AGKGGELTHDETTIIAGALELSEKMAKDAMTPISDTFVIDINAKLDRDLMNLILDKGHSR
VPVYYEQRTNIIGLVLVKNLLTINPDEEIQVKNVTIRRIPRVPETLPLYDILNEFQKGHS
HMAVVVRQCDKIHPLQSNDAANETVNEVRVDVDYERSPQETKLKRRRSLQKWKSFPNRAN
SLGSRSKRWSKDNDADILQLNEHPLPKLDEEEDAVGIITMEDVIEELLQEEIFDETDHHF
EDL

MAVEYVCCSPNFFIHIAVIVFLVLFAGLMSGLTLGLMSLSLVDLEVLAKSGTPEHRKYAA
KILPVVKNQHLLLVTLLICNAAAMETLPIFLDGLVTAWGAILISVTLILLFGEIIPQSIC
SRYGLAIGATVAPFVRVLVFICLPVAWPISKLLDFLLGHRRAALFRRAELKTLVDFHGNE
AGKGGELTHDETTIIAGALELSEKMVKDAMTPISDIFVIDINAKLDRDLMNLILEKGHSR
VPVYYEQPTNIIGLVLVKNLLTINPDEEIPVKNVTIRRIPRVPEILPLYDILNEFQKGLS
HMAVVVRQCDKIHPLPSKNGSVKEARVDVDSEGTPTPQERMLRTKRSLQKWKSFPNRASS
FKGGSKSKKWSKDNDADILQLNGNPLPKLAEEEEAVGIITMEDVIEELLQEEIFDETDHH
FEDS

www.000webhost.com

Other information
Ka divergence:0.316458KaKs divergence:0.606685
GC content 1 (%):41GC content 2 (%):42GC content divergence:0.012
Length 1 (bp):1272Length 2 (bp):1275Length divergence:0.001
MFE 1 (kcal):-361.5MFE 2 (kcal):-368.8MFE divergence0.01