Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G14580-AT2G14610
Species:Arabidopsis
Duplication type:TD
Function (paralog1):basic pathogenesis-related protein 1
Function (paralog2):pathogenesis-related gene 1

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-1.3105326085843
Log2 mRNA fold difference:-0.85875899173269
Log2 TE fold difference:0.17381868390923
Sequences
Protein sequence

MKVTSYSRILIILAALVGALVVPLKAQDSQQDYVNAHNQARSQIGVGPMQWDEGLAAYAR
NYANQLKGDCRLVHSRGPYGENLAKSGGDLSGVAAVNLWVNEKANYNYDTNTCNGVCGHY
TQVVWRNSVRLGCAKVRCNNGGTIISCNYDPPGNYANQKPY

MNFTGYSRFLIVFVALVGALVLPSKAQDSPQDYLRVHNQARGAVGVGPMQWDERVAAYAR
SYAEQLRGNCRLIHSGGPYGENLAWGSGDLSGVSAVNMWVSEKANYNYAANTCNGVCGHY
TQVVWRKSVRLGCAKVRCNNGGTIISCNYDPRGNYVNEKPY

Other information
Ka divergence:0.159117KaKs divergence:0.834516
GC content 1 (%):49GC content 2 (%):48GC content divergence:-0.01
Length 1 (bp):486Length 2 (bp):486Length divergence:0
MFE 1 (kcal):-148.5MFE 2 (kcal):-153.67MFE divergence0.017