Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G14720-AT2G14740
Species:Arabidopsis
Duplication type:TD
Function (paralog1):vacuolar sorting receptor 4
Function (paralog2):vaculolar sorting receptor 3

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.67478665045608
Log2 mRNA fold difference:-0.61669154148188
Log2 TE fold difference:-0.057858959270636
Sequences
Protein sequence

MKQLLCYLPWLLLLSLVVSPFNEARFVVEKNSLSVTSPESIKGTHDSAIGNFGIPQYGGS
MAGTVVYPKENQKSCKEFSDFSISFKSQPGALPTFLLVDRGDCFFALKVWNAQKAGASAV
LVADNVDEPLITMDTPEEDVSSAKYIENITIPSALVTKGFGEKLKKAISGGDMVNLNLDW
REAVPHPDDRVEYELWTNSNDECGVKCDMLMEFVKDFKGAAQILEKGGFTQFRPHYITWY
CPHAFTLSRQCKSQCINKGRYCAPDPEQDFSSGYDGKDVVVENLRQLCVYKVANETGKPW
VWWDYVTDFQIRCPMKEKKYNKDCAESVIKSLGIDSRKIDKCMGDPDADLDNPVLKEEQD
AQVGKGTRGDVTILPTLVVNNRQYRGKLEKSAVLKALCSGFEESTEPAICLSTDMETNEC
LDNNGGCWQDKSANITACKDTFRGKVCVCPIVDGVRFKGDGYSHCEPSGPGRCTINNGGC
WHEERDGHAFSACVDKDSVKCECPPGFKGDGVKKCEDINECKEKKACQCPECSCKNTWGS
YECSCSGDLLYMRDHDTCISKTGSQVKSAWAAVWLIMLSLGLAAAGAYLVYKYRLRQYMD
SEIRAIMAQYMPLDSQPEVPNHTNDERA

MKQLLCYLPWLLLLTLLVSPLNDARFVVEKNSLSVTSPESIKGTHDSAIGNFGIPQYGGS
MAGTVVYPKENQKSCKEFSDFSISFKSQPGALPTFLLVDRGDCFFALKVWNAQKAGASAV
LVADNVDEPLITMDTPEEDVSSAKYIENITIPSALVTKGFGEKLKKAISGGDMVNLNLDW
REAVPHPDDRVEYELWTNSNDECGVKCDMLMEFVKDFKGAAQILEKGGFTQFRPHYITWY
CPHAFTLSRQCKSQCINKGRYCAPDPEQDFSSGYDGKDVVVENLRQLCVYKVANETGKPW
VWWDYVTDFQIRCPMKEKKYNKECADSVIKSLGIDSKKLDKCMGDPDADLDNPVLKEEQD
AQVGKGSRGDVTILPTLVVNNRQYRGKLEKSAVLKALCSGFEETTEPAICLSTDVESNEC
LDNNGGCWQDKSANITACKDTFRGRVCECPTVDGVQFKGDGYSHCEPSGPGRCTINNGGC
WHEERDGHAFSACVDKDSVKCECPPGFKGDGTKKCEDINECKEKKACQCPECSCKNTWGS
YECSCSGDLLYIRDHDTCISKTGAQVRSAWAAVWLIMLSLGLAAAGAYLVYKYRLRQYMD
SEIRAIMAQYMPLDSQPEIPNHVNDERA

www.000webhost.com

Other information
Ka divergence:-0.171235KaKs divergence:-0.279271
GC content 1 (%):44GC content 2 (%):44GC content divergence:0
Length 1 (bp):1887Length 2 (bp):1887Length divergence:0
MFE 1 (kcal):-587.3MFE 2 (kcal):-598.9MFE divergence0.01