Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G14760-AT4G33880
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):basic helix-loop-helix (bHLH) DNA-binding superfamily protein
Function (paralog2):ROOT HAIR DEFECTIVE 6-LIKE 2

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:1.4825257534093
Log2 mRNA fold difference:2.1031423691499
Log2 TE fold difference:-1.0185055052299
Sequences
Protein sequence

MEAMGEWSTGLGGIYTEEADFMNQLLASYEQPCGGSSSETTATLTAYHHQGSQWNGGFCF
SQESSSYSGYCAAMPRQEEDNNGMEDATINTNLYLVGEETSECDATEYSGKSLLPLETVA
ENHDHSMLQPENSLTTTTDEKMFNQCESSKKRTRATTTDKNKRANKARRSQKCVEMSGEN
ENSGEEEYTEKAAGKRKTKPLKPQKTCCSDDESNGGDTFLSKEDGEDSKALNLNGKTRAS
RGAATDPQSLYARLKQLNKVHCMMVQKRRERINERLRILQHLVPNGTKVDISTMLEEAVQ
YVKFLQLQIKLLSSDDLWMYAPIAYNGMDIGLDLKLNALTR

MEAMGEWSNNLGGMYTYATEEADFMNQLLASYDHPGTGSSSGAAASGDHQGLYWNLGSHH
NHLSLVSEAGSFCFSQESSSYSAGNSGYYTVVPPTVEENQNETMDFGMEDVTINTNSYLV
GEETSECDVEKYSSGKTLMPLETVVENHDDEESLLQSEISVTTTKSLTGSKKRSRATSTD
KNKRARVNKRAQKNVEMSGDNNEGEEEEGETKLKKRKNGAMMSRQNSSTTFCTEEESNCA
DQDGGGEDSSSKEDDPSKALNLNGKTRASRGAATDPQSLYARKRRERINERLRILQNLVP
NGTKVDISTMLEEAVHYVKFLQLQIKLLSSDDLWMYAPIAFNGMDIGLSSPR

www.000webhost.com

Other information
Ka divergence:-0.0885536KaKs divergence:0.882024
GC content 1 (%):47GC content 2 (%):46GC content divergence:-0.011
Length 1 (bp):1026Length 2 (bp):1059Length divergence:0.016
MFE 1 (kcal):-306.1MFE 2 (kcal):-309.83MFE divergence0.006