Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G14850-AT4G33890
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:0.45730796386311
Log2 mRNA fold difference:0.59424984572875
Log2 TE fold difference:-0.14546482760683
Sequences
Protein sequence

MGSDQCFSRLNSLEIKALIYQKIGHQRADTYFDQLGKFLTSRISKSEFDKLCSKTVGREN
ISLHNRLVRSILKNASVAKSPPPRYPKKSLYGDPVFPPSPRKCRSRKFRDRPSPLGPLGK
PQSLTTTNDESMSKAQRLPMEVVSVEDGEEVEQMTGSPSVQSRSPLTAPLGVSFHLKSKA
RFSTYNGINRETCQSSGELPDMITLRARLEKKLEMEGIKLSMDSANLLNRGLNAYMRRLI
EPCLSLASQQKRAVSNVSMLDFHAAMEVNPRVLGEEWPIQLEKICCRASEE

MGSNQGSSRLDTLEIKALIYREIGNQRAESYFNQLGRFFALKITKSEFDKLCIKTIGRQN
IHLHNRLIRSIIKNACIAKSPPFIKKGGSFVRFGNGDSKKNSQIQPLHGDSAFSPSTRKC
RSRKLRDRPSPLGPLGKPHSLTTTNEESMSKAQSATELLSLGSRPPVEVVSVEEGEEVEQ
IAGGSPSVQSRCPLTAPLGVSMSLRNGATRKSVSNVSMCSRSFNRETCQNNGELPDTRTL
RSRLERRLEMEGLKITMDSVSLLNSGLDVFMRRLIEPCLSLANTRCGTDRVREMNYQYTQ
QSRRLSYVSMSDFRAGMELNTEILGEDWPMHMEKICSRASDK

Other information
Ka divergence:-0.104098KaKs divergence:0.29893
GC content 1 (%):45GC content 2 (%):43GC content divergence:-0.023
Length 1 (bp):876Length 2 (bp):1029Length divergence:0.08
MFE 1 (kcal):-291.44MFE 2 (kcal):-328.41MFE divergence0.06