Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G14860-AT4G33905
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein
Function (paralog2):Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:-2.0116690554817
Log2 mRNA fold difference:-1.4598570790094
Log2 TE fold difference:-0.44304428189976
Sequences
Protein sequence

MSRALFRNVAVDTARLIRRNAAASTDQYGKTGVAQSRPYFRSRQLLERAKETGVSPSPSL
GFSSSSSPSRIGFVGWYLGMVKSHPVVTKSVTSSLIYIAADLSSQTIAKTSSESYDLVRT
ARMGGYGLFVLGPTLHYWFNFMSRLFPKQDLITTFKKMAMGQTIYGPIMTVIFFSLNASL
QGERGSVILARLKRDLLPALFNGVMYWPLCDFITFRFFPVHLQPLVSNSFSYVWTIYMTY
MANREKPVAIST

MTGALFRNAASDAARIFRLQRATMTNPFGKLDPLPIGGNIQRLQSRPFYRTPQFLGKAKE
TGVSGFCSSSSSSSSTVSTAGFIGWYLGMVKSRPVLTKSVTSSLIYIAADLSSQTIPQAS
VDSYDLVRTARMGGYGLLILGPTLHYWFNLMSSLFPKRDLITTFKKMAMGQTVYGPAMNV
VFFSLNAALQGENGSEIVARLKRDLLPTMLNGVMYWPLCDFITFKFCPVYLQPLVSNSFS
YLWTIYITYMASRATPTAIEI

www.000webhost.com

Other information
Ka divergence:-0.000792068KaKs divergence:-0.358842
GC content 1 (%):44GC content 2 (%):45GC content divergence:0.011
Length 1 (bp):759Length 2 (bp):786Length divergence:0.017
MFE 1 (kcal):-212.7MFE 2 (kcal):-222.84MFE divergence0.023