Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G14880-AT4G34290
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):SWIB/MDM2 domain superfamily protein
Function (paralog2):SWIB/MDM2 domain superfamily protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:0.51888787976928
Log2 mRNA fold difference:0.057888113436064
Log2 TE fold difference:0.65916728623734
Sequences
Protein sequence

MAVSSGTFSTFLCIKTTSFRNPSTPLSSLRFASHPAAKLRLVRAVTSATESSEPTATNKR
VPRGIMKPRPVSPEMQDIVELPEIARTQALKRIWAYIKEHDLQDPQNKREILCDEKLKKI
FEGRDRVGFLEIAKLIGPHFL

MALSSGIFSTTFLCVDTAPLRSSMLSPSSLRLSPNHPTNLRMVRAVTSAAAASSDPTTTT
KTREPRGIMKPRPVSQAMQDVVGVPEIPRTQALKRIWAYIKEHDLQDPQNKRDILCDEKL
KKIFEGKERVGFLEIAKLIGPHFL

www.000webhost.com

Other information
Ka divergence:-0.464721KaKs divergence:0.99978
GC content 1 (%):48GC content 2 (%):51GC content divergence:0.03
Length 1 (bp):426Length 2 (bp):435Length divergence:0.01
MFE 1 (kcal):-106.1MFE 2 (kcal):-119.52MFE divergence0.059