Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G15090-AT4G34250
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):3-ketoacyl-CoA synthase 8
Function (paralog2):3-ketoacyl-CoA synthase 16

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.67380588412553
Log2 mRNA fold difference:-0.76247859450685
Log2 TE fold difference:0.14390163892971
Sequences
Protein sequence

MKNLKMVFFKILFISLMAGLAMKGSKINVEDLQKFSLHHTQNNLQTISLLLFLVVFVWIL
YMLTRPKPVYLVDFSCYLPPSHLKVSIQTLMGHARRAREAGMCWKNKESDHLVDFQEKIL
ERSGLGQETYIPEGLQCFPLQQGMGASRKETEEVIFGALDNLFRNTGVKPDDIGILVVNS
STFNPTPSLASMIVNKYKLRDNIKSLNLGGMGCSAGVIAVDVAKGLLQVHRNTYAIVVST
ENITQNLYLGKNKSMLVTNCLFRVGGAAVLLSNRSRDRNRAKYELVHTVRIHTGSDDRSF
ECATQEEDEDGIIGVTLTKNLPMVAARTLKINIATLGPLVLPLKEKLAFFITFVKKKYFK
PELRNYTPDFKLAFEHFCIHAGGRALIDELEKNLKLSPLHVEASRMTLHRFGNTSSSSIW
YELAYTEAKGRMKEGDRIWQIALGSGFKCNSSVWVALRDVKPSANSPWEDCMDRYPVEID
I

MDYPMKKVKIFFNYLMAHRFKLCFLPLMVAIAVEASRLSTQDLQNFYLYLQNNHTSLTMF
FLYLALGSTLYLMTRPKPVYLVDFSCYLPPSHLKASTQRIMQHVRLVREAGAWKQESDYL
MDFCEKILERSGLGQETYVPEGLQTLPLQQNLAVSRIETEEVIIGAVDNLFRNTGISPSD
IGILVVNSSTFNPTPSLSSILVNKFKLRDNIKSLNLGGMGCSAGVIAIDAAKSLLQVHRN
TYALVVSTENITQNLYMGNNKSMLVTNCLFRIGGAAILLSNRSIDRKRAKYELVHTVRVH
TGADDRSYECATQEEDEDGIVGVSLSKNLPMVAARTLKINIATLGPLVLPISEKFHFFVR
FVKKKFLNPKLKHYIPDFKLAFEHFCIHAGGRALIDEMEKNLHLTPLDVEASRMTLHRFG
NTSSSSIWYELAYTEAKGRMTKGDRIWQIALGSGFKCNSSVWVALRNVKPSTNNPWEQCL
HKYPVEIDIDLKE

www.000webhost.com

Other information
Ka divergence:0.0151852KaKs divergence:0.599396
GC content 1 (%):43GC content 2 (%):44GC content divergence:0.011
Length 1 (bp):1446Length 2 (bp):1482Length divergence:0.012
MFE 1 (kcal):-428.39MFE 2 (kcal):-439.49MFE divergence0.013