Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G15300-AT4G34220
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Leucine-rich repeat protein kinase family protein
Function (paralog2):Leucine-rich repeat protein kinase family protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:2.0627176765387
Log2 mRNA fold difference:1.8121022246384
Log2 TE fold difference:0.35608516752328
Sequences
Protein sequence

MTSNRSNLFLHLLLLHLPTLIQALNTDGVALLSFKYSILNDPLLVLRNWNYDDETPCSWT
GVTCTELGIPNTPDMFRVTSLVLPNKQLLGSVSPDLFSILHLRILDLSDNFFHGSLPDSV
SNASELRILSLGNNKVSGELPRSISNVASLQLLNLSANALTGKIPPNLSLPKNLTVISLA
KNSFSGDIPSGFEAVQVLDISSNLLDGSLPPDFRGTSLLYLNLSNNQISGMISPPFAEKF
PASAIIDLSFNNLTGPIPNTPPLLNQKTESFSGNIGLCGQPLKTLCSIPSTLSDPPNISE
TTSPAIAVMPTTPTPTNSSTESTNQTAKSKLKPSTIIGITLADIAGLAIIAMFILYIYQL
KKRRSYQEYSTFNVLQKCLEKNDTLSVKKSKHNVADALEFTKSPPAKMGCGSWISRRYEE
TTSVSSESDIENQKPVEAFDRTGGGRVKHNTETQLVTVDGETQLELDTLLKASAYVLGTN
RSDGIVYKAVLENGAAFAVRRIGAESCPAAKFKEFEKEVQGIAKLRHPNLVRVRGFVWGK
EEKLLISDYVPNGNLPLSSISAKSSSFSHKPLSFEARLKLARGIARGIAYIHDKKHVHGN
IKANNILLDSEFEPVITDMGLDRIMTSAHLLTDGPLSSLQDQPPEWSTSQKPNPKWDVYS
FGVILLELLTGIVFSVDRDLVRDSETDEKSWFLKLVDGEIRVEVAHREDEAVACLKLGYE
CVSSLPQKRPSMKEVVQVLEKMFV

MTSNRSNLLFSLVLFHFLFVPTQLQALNTDGVLLLTFKYSILTDPLSVLRNWNYDDATPC
LWTGVTCTELGKPNTPDMFRVTSLVLPNKHLLGSITPDLFSIPYLRILDLSSNFFNGSLP
DSVFNATELQSISLGSNNLSGDLPKSVNSVTNLQLLNLSANAFTGEIPLNISLLKNLTVV
SLSKNTFSGDIPSGFEAAQILDLSSNLLNGSLPKDLGGKSLHYLNLSHNKVLGEISPNFA
EKFPANATVDLSFNNLTGPIPSSLSLLNQKAESFSGNQELCGKPLKILCSIPSTLSNPPN
ISETTSPAIAVKPRSTAPINPLTEKPNQTGKSKLKPSTIAAITVADIVGLAFIGLLVLYV
YQVRKRRRYPESSKFSFFKFCLEKNEAKKSKPSTTEVTVPESPEAKTTCGSCIILTGGRY
DETSTSESDVENQQTVQAFTRTDGGQLKQSSQTQLVTVDGETRLDLDTLLKASAYILGTT
GTGIVYKAVLENGTAFAVRRIETESCAAAKPKEFEREVRAIAKLRHPNLVRIRGFCWGDD
EKLLISDYVPNGSLLCFFTATKASSSSSSSSSLQNPLTFEARLKIARGMARGLSYINEKK
QVHGNIKPNNILLNAENEPIITDLGLDRLMTPARESHTTGPTSSSPYQPPEWSTSLKPNP
KWDVYSFGVILLELLTSKVFSVDHDIDQFSNLSDSAAEENGRFLRLIDGAIRSDVARHED
AAMACFRLGIECVSSLPQKRPSMKELVQVLEKICVLV

www.000webhost.com

Other information
Ka divergence:-0.052014KaKs divergence:0.223799
GC content 1 (%):45GC content 2 (%):46GC content divergence:0.011
Length 1 (bp):2235Length 2 (bp):2274Length divergence:0.009
MFE 1 (kcal):-611.69MFE 2 (kcal):-645.96MFE divergence0.027