Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G15400-AT2G15430
Species:Arabidopsis
Duplication type:TD
Function (paralog1):DNA-directed RNA polymerase family protein
Function (paralog2):DNA-directed RNA polymerase family protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:1.7661240426123
Log2 mRNA fold difference:2.5570805608706
Log2 TE fold difference:-0.78446957970853
Sequences
Protein sequence

MDGVTYQRFPTVKIRELKDDYAKFELRETDVSMANALRRVMISEVPTMAIHLVKIEVNSS
VLNDEFIAQRLSLIPLTSERAMSMRFCQDCEDCNGDEHCEFCSVEFPLSAKCVTDQTLDV
TSRDLYSADPTVTPVDFTSNSSTSDSSEHKGIIIAKLRRGQELKLKALARKGIGKDHAKW
SPAATVTYMYEPDIIINEEMMNTLTDEEKIDLIESSPTKVFGIDPVTGQVVVVDPEAYTY
DEEVIKKAEAMGKPGLIEIHPKHDSFVFTVESTGALKASQLVLNAIDILKQKLDAIRLSD
NTVEADDQFGELGAHMREG

MDGATYQRFPKIKIRELKDDYAKFELRETDVSMANALRRVMISEVPTVAIDLVEIEVNSS
VLNDEFIAHRLGLIPLTSERAMSMRFSRDCDACDGDGQCEFCSVEFRLSSKCVTDQTLDV
TSRDLYSADPTVTPVDFTIDSSVSDSSEHKGIIIVKLRRGQELKLRAIARKGIGKDHAKW
SPAATVTFMYEPDIIINEDMMDTLSDEEKIDLIESSPTKVFGMDPVTRQVVVVDPEAYTY
DEEVIKKAEAMGKPGLIEISPKDDSFIFTVESTGAVKASQLVLNAIDLLKQKLDAVRLSD
DTVEADDQFGELGAHMRGG

www.000webhost.com

Other information
Ka divergence:-0.644967KaKs divergence:-0.999903
GC content 1 (%):45GC content 2 (%):45GC content divergence:0
Length 1 (bp):960Length 2 (bp):960Length divergence:0
MFE 1 (kcal):-276.49MFE 2 (kcal):-282.47MFE divergence0.011