Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G15480-AT2G15490
Species:Arabidopsis
Duplication type:TD
Function (paralog1):UDP-glucosyl transferase 73B5
Function (paralog2):UDP-glycosyltransferase 73B4

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-0.92017335707234
Log2 mRNA fold difference:-0.7299433535065
Log2 TE fold difference:-0.1536457898058
Sequences
Protein sequence

MNREVSERIHILFFPFMAQGHMIPILDMAKLFSRRGAKSTLLTTPINAKIFEKPIEAFKN
QNPDLEIGIKIFNFPCVELGLPEGCENADFINSYQKSDSGDLFLKFLFSTKYMKQQLESF
IETTKPSALVADMFFPWATESAEKLGVPRLVFHGTSFFSLCCSYNMRIHKPHKKVATSST
PFVIPGLPGDIVITEDQANVAKEETPMGKFMKEVRESETNSFGVLVNSFYELESAYADFY
RSFVAKRAWHIGPLSLSNRELGEKARRGKKANIDEQECLKWLDSKTPGSVVYLSFGSGTN
FTNDQLLEIAFGLEGSGQSFIWVVRKNENQGDNEEWLPEGFKERTTGKGLIIPGWAPQVL
ILDHKAIGGFVTHCGWNSAIEGIAAGLPMVTWPMGAEQFYNEKLLTKVLRIGVNVGATEL
VKKGKLISRAQVEKAVREVIGGEKAEERRLWAKKLGEMAKAAVEEGGSSYNDVNKFMEEL
NGRK

MNREQIHILFFPFMAHGHMIPLLDMAKLFARRGAKSTLLTTPINAKILEKPIEAFKVQNP
DLEIGIKILNFPCVELGLPEGCENRDFINSYQKSDSFDLFLKFLFSTKYMKQQLESFIET
TKPSALVADMFFPWATESAEKIGVPRLVFHGTSSFALCCSYNMRIHKPHKKVASSSTPFV
IPGLPGDIVITEDQANVTNEETPFGKFWKEVRESETSSFGVLVNSFYELESSYADFYRSF
VAKKAWHIGPLSLSNRGIAEKAGRGKKANIDEQECLKWLDSKTPGSVVYLSFGSGTGLPN
EQLLEIAFGLEGSGQNFIWVVSKNENQVGTGENEDWLPKGFEERNKGKGLIIRGWAPQVL
ILDHKAIGGFVTHCGWNSTLEGIAAGLPMVTWPMGAEQFYNEKLLTKVLRIGVNVGATEL
VKKGKLISRAQVEKAVREVIGGEKAEERRLRAKELGEMAKAAVEEGGSSYNDVNKFMEEL
NGRK

www.000webhost.com

Other information
Ka divergence:0.300127KaKs divergence:0.99979
GC content 1 (%):44GC content 2 (%):44GC content divergence:0
Length 1 (bp):1455Length 2 (bp):1455Length divergence:0
MFE 1 (kcal):-450.52MFE 2 (kcal):-446MFE divergence-0.005