Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G15480-AT4G34131
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):UDP-glucosyl transferase 73B5
Function (paralog2):UDP-glucosyl transferase 73B3

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:1.356203637078
Log2 mRNA fold difference:1.3251446059474
Log2 TE fold difference:0.0028098370306912
Sequences
Protein sequence

MNREVSERIHILFFPFMAQGHMIPILDMAKLFSRRGAKSTLLTTPINAKIFEKPIEAFKN
QNPDLEIGIKIFNFPCVELGLPEGCENADFINSYQKSDSGDLFLKFLFSTKYMKQQLESF
IETTKPSALVADMFFPWATESAEKLGVPRLVFHGTSFFSLCCSYNMRIHKPHKKVATSST
PFVIPGLPGDIVITEDQANVAKEETPMGKFMKEVRESETNSFGVLVNSFYELESAYADFY
RSFVAKRAWHIGPLSLSNRELGEKARRGKKANIDEQECLKWLDSKTPGSVVYLSFGSGTN
FTNDQLLEIAFGLEGSGQSFIWVVRKNENQGDNEEWLPEGFKERTTGKGLIIPGWAPQVL
ILDHKAIGGFVTHCGWNSAIEGIAAGLPMVTWPMGAEQFYNEKLLTKVLRIGVNVGATEL
VKKGKLISRAQVEKAVREVIGGEKAEERRLWAKKLGEMAKAAVEEGGSSYNDVNKFMEEL
NGRK

MSSDPHRKLHVVFFPFMAYGHMIPTLDMAKLFSSRGAKSTILTTPLNSKIFQKPIERFKN
LNPSFEIDIQIFDFPCVDLGLPEGCENVDFFTSNNNDDRQYLTLKFFKSTRFFKDQLEKL
LETTRPDCLIADMFFPWATEAAEKFNVPRLVFHGTGYFSLCSEYCIRVHNPQNIVASRYE
PFVIPDLPGNIVITQEQIADRDEESEMGKFMIEVKESDVKSSGVIVNSFYELEPDYADFY
KSVVLKRAWHIGPLSVYNRGFEEKAERGKKASINEVECLKWLDSKKPDSVIYISFGSVAC
FKNEQLFEIAAGLETSGANFIWVVRKNIGIEKEEWLPEGFEERVKGKGMIIRGWAPQVLI
LDHQATCGFVTHCGWNSLLEGVAAGLPMVTWPVAAEQFYNEKLVTQVLRTGVSVGAKKNV
RTTGDFISREKVVKAVREVLVGEEADERRERAKKLAEMAKAAVEGGSSFNDLNSFIEEFT
S

Other information
Ka divergence:-0.0350387KaKs divergence:-0.535836
GC content 1 (%):44GC content 2 (%):45GC content divergence:0.011
Length 1 (bp):1455Length 2 (bp):1446Length divergence:-0.003
MFE 1 (kcal):-450.52MFE 2 (kcal):-468.94MFE divergence0.02