Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G15530-AT4G34040
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):RING/U-box superfamily protein
Function (paralog2):RING/U-box superfamily protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-0.03381399154565
Log2 mRNA fold difference:-0.021827844126841
Log2 TE fold difference:-0.059695983672837
Sequences
Protein sequence

MNPMQGPRSIGGSSTEVNQVDGESIYCTETSLNTMLNPADTGFPNNSTPSGRPTYASSSS
HAAQDHTWWRFGESSSIPGPSDQVNSIGIKTSHQLPQDGTHHFVGYGSEGRQTGLNGMMV
DGGVHAGSHIRNVPSFLRGSSSNPMPQHVDMSMDMDSDNCNAQTSGVVIRHNSYGSSLGS
SVQAAGESSSGPASPFGGWGSSCKRKALEGSPSHYFSGETPNRIVQTENSASHASLSQYG
ASSSLSLATPSQSSPNVTNHFGRTEQMFGSGGGRAVAASAFHSTRNTDTLSRAGRRLNPR
QPQESVAFSVSHGGTSVRPTGSLQQNLPLNSPFVDPPDVRSSSITSGSNTGENQTNIVHL
PALTRNIHQYAWDASFSSRASNPSGIGMPAERLGPQWETPRSNQEQPLFAPATDMRQPVH
DLWNFARGSPGSSVDSLFVPRAGPSSAIHTPQPNPTWIPPQNAPPHNPSRTSELSPWSLF
PSIESPSASHGGPLPLLPAGPSVSSNEVTMPSSSNSRSHRSRHRRSGLLLERQNELLHLR
HIGRSLAADGNGRNQIISEIRQVLHAMRRGENLRVEDYMVFDPLIYQGMTDMHDRHREMR
LDVDNMSYEELLALGERIGDVSTGLSEEVILKAMKQHKHTSSSPSSVELHQNIEPCCICQ
EEYVEGDNLGTLKCGHEFHKDCIKQWVMIKNLCPIFRFNKERRLCLFIMRMIKMIVPKPL
GTSDKIGTIQRRLAWLLRKDDTYKSEKCYKKFSIQNFQIDFSELIVLLNNINFGSHSMNL

MQGPRSTGDSSTGINYADGEPICSTNSETTSNNILNPVDVQFPNNTTGSGRPTYASSSSH
VVQNHNWWSFGESSSRLGPSDHLNSNGSKTDRQLLSDGYGFEEGQSGMLLPGESFLRGSS
SSHMLSHVNLGKDMDIGSGLQTSGVVIRHNNCETSLGSSSQTAEERSSGPGSSLGGLGSS
CKRKALEGAPSHSFPGESHGCFFQTENGAWNEGLAQYDASSSLSLSMPSQNSPNVNNQSG
LPEPRFGLGGGRAVTASAFPSTRSTETISRPGRRLNPGQPPESVAFSFTQSGSSVRQQQQ
LPATSPFVDPLDARAIPVTGSSSSGDGQPSMIHLPALTRNIHQFAWSASSSSRANSMPEE
GLSPWDAPRINSEQPVFTTPANETRNPVQDQFCWSFTRGNPSTSGDSPFVPRAGSSSGIH
GLQPNPTWVTPHNQSRISEVAPWSLFPSIESESATHGASLPLLPTGPSVSSNEAAAPSGS
SSRSHRSRQRRSGLLLERQNDHLHLRHLGRSLAADNDGRNRLISEIRQVLSAMRRGENLR
FEDYMVFDPLIYQGMAEMHDRHRDMRLDVDNMSYEELLALGERIGDVSTGLSEEVILKVM
KQHKHTSSAAGSHQDMEPCCVCQEEYAEGDDLGTLGCGHEFHTACVKQWLMLKNLCPICK
TVALST

www.000webhost.com

Other information
Ka divergence:-0.355133KaKs divergence:-0.427828
GC content 1 (%):44GC content 2 (%):46GC content divergence:0.022
Length 1 (bp):2343Length 2 (bp):2001Length divergence:-0.079
MFE 1 (kcal):-719.39MFE 2 (kcal):-637.7MFE divergence-0.06