Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G15880-AT4G33970
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Leucine-rich repeat (LRR) family protein
Function (paralog2):Leucine-rich repeat (LRR) family protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-4.6363855596935
Log2 mRNA fold difference:-3.7458462526821
Log2 TE fold difference:-0.97168462538729
Sequences
Protein sequence

MPHIYKQPLGIFQGFVPTLTDAEVSFIAQRQLLTLPENGELPDDIEYEVDLKVTFANHRL
KRAYIALQAWKKAVYSDPFNTTGNWHGPHVCGYTGVFCAPALDDPDVAVVAGVDLNGADI
AGHLPAELGLMTDVAMFHLNSNRFCGIIPKSFEKLSLMHEFDVSNNRFVGPFPSVVLSWP
AVKFIDVRYNDFEGQVPPELFKKDLDAIFLNNNRFTSTIPDSLGESSASVVTFAHNKFSG
CIPRSIGNMKNLNEIIFKDNSLGGCFPSEIGKLANVNVFDASMNSFTGVLPPSFVGLTSM
EEFDISGNKLTGFIPENICKLPKLVNLTYAYNYFNGQGDSCVPGSQKQIALDDTRNCLPD
RPKQRSAKECAVVISRPVDCSKDKCAGGSSQATPSKSPSPVPTRPVHKPQPPKESPQPND
PYNQSPVKFRRSPPPPQQPHHHVVHSPPPASSPPTSPPVHSTPSPVHKPQPPKESPQPND
PYDQSPVKFRRSPPPPPVHSPPPPSPIHSPPPPPVYSPPPPPPVYSPPPPPPVYSPPPPP
PVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPPVHSPPPPVH
SPPPPVHSPPPPVYSPPPPPPVHSPPPPVFSPPPPVHSPPPPVYSPPPPVYSPPPPPVKS
PPPPPVYSPPLLPPKMSSPPTQTPVNSPPPRTPSQTVEAPPPSEEFIIPPFIGHQYASPP
PPMFQGY

MPFYKQPWVFSKVFVLAMAKPPSFGCCFFLLFFSFLSSSFVSFALTDTEAAFIVQRQLLT
LPDNGELPDDIEYEVDLKATFANTRLKRAYIALQAWKKAIFSDPFNTTGNWHGPHVCGYT
GVVCAPALDDSDVTVVAGVDLNGADIAGHLPAELGLMTDVAMFHLNSNRFCGIIPKSFEK
LKLMHEFDVSNNRFVGPFPNVVLSWPDVKYFDLRFNDFEGQVPPELFKKELDAIFLNDNR
FTSVIPESLGESPASVVTFANNKFTGCIPKSIGNMKNLNEIVFMDNDLGGCFPSEIGKLS
NVTVFDASKNSFIGRLPTSFVGLTSVEEIDISGNKLTGLVPHNICQLPNLVNLTYSYNYF
SGQGGSCVPGGSRKEIALDDTRNCLASRPEQRSAQECAVVINRPVDCSKDKCAGGSSTPS
KPSPVHKPTPVPTTPVHKPTPVPTTPVQKPSPVPTTPVQKPSPVPTTPVHEPSPVLATPV
DKPSPVPSRPVQKPQPPKESPQPDDPYDQSPVTKRRSPPPAPVNSPPPPVYSPPPPPPPV
HSPPPPVHSPPPPPVYSPPPPPPPVHSPPPPVFSPPPPVYSPPPPVHSPPPPVHSPPPPA
PVHSPPPPVHSPPPPPPVYSPPPPVFSPPPSQSPPVVYSPPPRPPKINSPPVQSPPPAPV
EKKETPPAHAPAPSDDEFIIPPFIGHQYASPPPPMFAGY

Other information
Ka divergence:0.0879237KaKs divergence:-0.216495
GC content 1 (%):50GC content 2 (%):51GC content divergence:0.01
Length 1 (bp):2184Length 2 (bp):2100Length divergence:-0.02
MFE 1 (kcal):-575.41MFE 2 (kcal):-595.48MFE divergence0.017