Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G16200-AT4G34450
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):structural molecules
Function (paralog2):coatomer gamma-2 subunit, putative / gamma-2 coat protein, putative / gamma-2 COP, putative

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:4.1121503003372
Log2 mRNA fold difference:2.3385197286518
Log2 TE fold difference:1.3817549132395
Sequences
Protein sequence

MDLYKTLELKELSCTSLLKGTETVASNARSHTCLPSGLYIGNVKVLVKAQFGMDSSKEIV
MKLAVRAEDPSVSDAIHALVANG

MAQPLVKKDDDHDDELEYSPFMGIEKGAVLQEARVFNDPQVDPRRCSQVITKLLYLLNQG
ESFTKVEATEVFFSVTKLFQSKDTGLRRMVYLIIKELSPSSDEVIIVTSSLMKDMNSKID
MYRANAIRVLCRIIDGTLLTQIERYLKQAIVDKNPVVSSAALVSGLHLLKTNPEIVKRWS
NEVQEGIQSRSALVQFHALALLHQIRQNDRLAVSKLVGSLTRGSVRSPLAQCLLIRYTSQ
VIRDMANHGQSGERPFYEFLESCLRHKAEMVILEAARAITELDGVTSRELTPAITVLQLF
LSSPRPVLRFAAVRTLNKVAMTHPMAVTNCNIDMESLISDQNRSIATLAITTLLKTGNES
SVERLMKQITNFMSDIADEFKIVVVDAIRSLCVKFPLKYRSLMTFLSNILREEGGFEYKR
AIVDSIVTIIRDIPDAKESGLLHLCEFIEDCEFTYLSTQILHFLGIEGPNTSDPSKYIRY
IYNRVHLENATVRAAAVSTLAKFGFMVESLKPRITVLLKRCIYDSDDEVRDRATLYLSVL
GGDGTVDTDKESKDFLFGSLEVPLVNMETSLKNYEPSEEAFDINSVPKEVKSQPLAEKKA
QGKKPTGLGAPPAAPASGFDGYERLLSSIPEFAAFGKLFKSSLPVELTEAETEYAVNVVK
HIFDSHVVFQYNCTNTIPEQLLERVNVIVDASEAEEFSEVTSKALNSLPYDSPGQAFVVF
EKPAGVPAVGKFSNTLTFVVKEVDPSTGEAEDDGVEDEYQLEDLEVVAGDYMVKVGVSNF
RNAWESMDEEDERVDEYGLGQRESLGEAVKAVMDLLGMQTCEGTETIPLNARSHTCLLSG
VYIGNVKVLVRAQFGMDSSKDIAMKLTVRAEDVSVAEAIHEIVASG

www.000webhost.com

Other information
Ka divergence:-0.691299KaKs divergence:0.708232
GC content 1 (%):43GC content 2 (%):44GC content divergence:0.011
Length 1 (bp):252Length 2 (bp):2661Length divergence:0.827
MFE 1 (kcal):-64.76MFE 2 (kcal):-863.43MFE divergence0.86