Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G16230-AT4G34480
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):O-Glycosyl hydrolases family 17 protein
Function (paralog2):O-Glycosyl hydrolases family 17 protein

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:0.9031021720571
Log2 mRNA fold difference:0.48857132048797
Log2 TE fold difference:0.42420177787183
Sequences
Protein sequence

MALSILFLLLFILFSISPSNAQSFIGVNYGLLSDNLPPPSQTAKLLQSTSIQKVRLYNAD
SSIITSLVGTGIGIVIGVANGDLPSIASDLNIASQWINSNVLPFYPASNIILINVGNEVL
LSNDLNLVNQLLPAMQNVQKALEAVSLGGKIKVSTVHAMTVLGNSEPPSAGSFAPSYQAG
LKGILQFLSDTGSPFAINPYPFFAYQSDPRPETLAFCLFQPNPGRVDSNTGIKYMNMFDA
QVDAVHSALKSIGFEKVEVLVAETGWPSTGDSNEVGPSVENAKAYNGNLIAHLRSMVGTP
LMPGKSIDTYIFALFDENLKPGPSFEQSFGLFKPDLSMAYDIGLTKTTSSQTSQSPQLGK
VTSMGWCVPKEDATQEQLQDSLDWVCGQGIDCGPIMPGGVCFEPNNVASHTAYAMNLYFQ
KSPENPTDCDFSKTARITSENPSYSSCVYPRAGDGSITGEVTKYVTSDKATEKNGSECFS
SLYLARFIISIYFFCLFPSLRIM

MALSISIYFLLIFLSHFPSSHAEPFIGVNYGQVADNLPPPSETVKLLQSTSIQKVRLYGA
DPAIIKALAGTGVGIVIGAANGDVPSLASDPNAATQWINSNVLPFYPASKIMLITVGNEI
LMSNDPNLVNQLLPAMQNVQKALEAVSLGGKIKVSTVNSMTVLGSSDPPSSGSFAAGYQT
GLKGILQFLSDTGSPFAINPYPFFAYQSDPRPETLAFCLFEPNAGRVDSKTGIKYTNMFD
AQVDAVHSALKSMGFEKVEIVVAETGWASRGDANEVGASVDNAKAYNGNLIAHLRSMVGT
PLMPGKPVDTYIFALYDENLKPGPSSERAFGLFKTDLSMVYDVGLAKSSSSSQTPSGKVT
SSGWCVPKKGATNEELQASLDWACGHGIDCGAIQPGGACFEPNNVVSHAAYAMNMYFQKS
PKQPTDCDFSKTATVTSQNPSYNNCVYPGGGGGGGGGGGGSKAVMNKYVSSDKVEKKNGA
TEPKVSSSLSFLLIFLSLIFHVYM

www.000webhost.com

Other information
Ka divergence:-0.261363KaKs divergence:-0.283349
GC content 1 (%):46GC content 2 (%):49GC content divergence:0.032
Length 1 (bp):1512Length 2 (bp):1515Length divergence:0.001
MFE 1 (kcal):-438.26MFE 2 (kcal):-495.76MFE divergence0.062