Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G16370-AT4G34570
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):thymidylate synthase 1
Function (paralog2):thymidylate synthase 2

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-2.3330939109959
Log2 mRNA fold difference:-2.4998147175586
Log2 TE fold difference:0.095670721360897
Sequences
Protein sequence

MATTTLNDSVTTTLASEPQRTYQVVVAATKEMGIGKDGKLPWNLPTDLKFFKDITLTTSD
SSKKNAVVMGRKTWESIPIKYRPLSGRLNVVLTRSGGFDIANTENVVTCSSVDSALDLLA
APPYCLSIERVFVIGGGDILREALNRPSCDAIHLTEIDTSVDCDTFIPAIDTSVYQPWSS
SFPVTENGLRFCFTTFVRVKSSADESSDESNGSQSLQFDGKKFLFLPKMVFDQHEEFLYL
NMVEDIISNGNVKNDRTGTGTLSKFGCQMKFNLRRSFPLLTTKRVFWRGVVEELLWFISG
STNAKVLQEKGIHIWDGNASREYLDGIGLTEREEGDLGPVYGFQWRHFGAKYTDMHADYT
GQGFDQLVDVIDKIKNNPDDRRIIMSAWNPSDLKLMALPPCHMFAQFYVAEGELSCQMYQ
RSADMGLGVPFNIASYSLLTCMLAHVCDLVPGDFIHVLGDAHVYKTHVRPLQEQLLNLPK
PFPVMKINPEKKQIDSFVASDFDLTGYDPHKKIEMKMAV

MRCLQNSAKTLPLAFKSALLPLSQRWFCKFSPKPSSLTNIFKVSISTMANTLNGNVIMTS
KPQSTYQVVVAATKEMGIGKDGKLPWNLPTDLKFFKDLTLSTSDSAKKNAVVMGRKTWES
IPKKYRPLSGRLNVVLSRSSGFDIANTENVVTCSSIDSALDLLAAPPFSLSIEKVFVIGG
GDILREALNKPSCEAIHITEIDTSIDCDTFIPTVDTSAYQPWCSSFPICENGLRFSFTTH
VRVKSSSAGEASDESDGSKVLQVDWKKFSSVLPKMIFDRHEEYLYLNLVKEIISNGNLKD
DRTGTGTLSKFGCQMKFNLRRNFPLLTTKRVFWRGVVEELLWFISGSTNAKVLQEKGIRI
WDGNASRAYLDGIGLTEREEGDLGPVYGFQWRHFGAKYTDMHADYTGQGFDQLLDVINKI
KNNPDDRRIIMSAWNPSDLKLMALPPCHMFAQFYVANGELSCQMYQRSADMGLGVPFNIA
SYSLLTCILAHVCDLVPGDFIHVIGDAHVYKNHVRPLQEQLENPPKPFPVLKINPEKKDI
DSFVADDFELIGYDPHKKIDMKMAV

Other information
Ka divergence:-0.262832KaKs divergence:-0.313407
GC content 1 (%):41GC content 2 (%):41GC content divergence:0
Length 1 (bp):1560Length 2 (bp):1698Length divergence:0.042
MFE 1 (kcal):-459.37MFE 2 (kcal):-485.25MFE divergence0.027